(data stored in ACNUC1104 zone)

EMBL: CP002026.PE89

CP002026.PE89        Location/Qualifiers
FT   CDS_pept        80106..80723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0089"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bbt:BBta_0530 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87426"
FT                   /db_xref="GOA:D7A012"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A012"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87426.1"
FT                   /translation="MAQLGEVFIVDDDSAVRDALSLVLSLEGYHVRSFSDGAAFLSVAR
FT                   THVPACIVLDVHMPGRSGLDILKELEADRYPAPIFIISGQGDIPMAVDAIRHGALDFIE
FT                   KPFDADTVVERVRDAIEAHSRRGSSEPGDLLTAHFPGHEMLTPREREVLVQIASGASNK
FT                   EAGRKLGISPRTIEVHRARIMEKLGAKNAADLVRIVLKDMRA"
     atggcgcagc tgggtgaggt cttcatcgtc gacgacgatt ccgcggtgcg cgacgcgctc        60
     tcgctggtgc tcagtcttga aggctaccac gtacgcagct tctcggacgg cgcggccttc       120
     ctctcggtgg cccgtaccca tgtgccggcc tgcatcgtgc tcgacgtgca catgcccggc       180
     cgatccggcc tcgacatcct caaggagctg gaggcggacc gctatccggc gccgatcttc       240
     atcatctccg gccagggcga tatcccgatg gcggtggacg cgatccgcca cggcgcgctc       300
     gatttcatcg agaagccgtt cgacgccgac acggtggtcg agcgcgtgcg cgatgccatc       360
     gaggcgcaca gccggcgcgg ttcctcggaa ccgggcgacc tgctgacggc gcattttccc       420
     ggccacgaga tgctcacacc gcgcgagcgc gaggtgctgg tgcagatcgc ctccggcgcc       480
     tccaacaagg aggcgggacg caagctcggc atctcgccgc gcaccatcga ggtgcaccgc       540
     gcccgcatca tggagaagct cggcgccaag aacgccgccg acctggtgcg catcgtgctc       600
     aaggacatgc gggcttaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page