(data stored in ACNUC1104 zone)

EMBL: CP002026.PE9

CP002026.PE9         Location/Qualifiers
FT   CDS_pept        6307..6900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL1123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87346.1"
FT                   /translation="MGMVGRPRIETRERYACGKAKSKPEVASPAMVRRIINEARRGAAD
FT                   PALGSVIGQLRLRDIIDTRQMSAGLRYAELCADFDRMKGIPRRSAASPSYQAGLRRTGG
FT                   NDAEDEGIVAELLRNGGDVRELAKKNARLRALVRIVTAHEAAQKALLECGQPVWRLVRE
FT                   VAIYDRTIDAWHRPQLIRGLDALLAHFDLTGFRK"
     atgggaatgg tcggtcggcc gcgtatcgag acgcgggaac ggtatgcctg cggcaaggcg        60
     aagtcgaagc cggaggtggc gtctcccgcc atggttcggc gcatcatcaa cgaggcccgg       120
     cgcggggcgg ctgaccctgc gctcggctcg gtcatcggcc agcttcggct gcgcgacatc       180
     atcgacacgc ggcagatgag cgccggcctg cgctatgccg agctttgcgc ggacttcgac       240
     cggatgaagg gtattccgcg ccgttcggcc gccagccctt cctaccaggc gggcctgcgc       300
     cgcacgggcg ggaatgatgc cgaagacgag ggcatcgtgg ccgagctgct gcgcaatggt       360
     ggcgacgtgc gcgaactggc gaagaagaat gcccggctgc gtgccctggt gcggatcgtc       420
     accgctcacg aggcggcgca gaaggcgctt ctggagtgcg ggcagcccgt gtggcggctg       480
     gtgcgcgagg tggcgatata cgaccggacc atcgacgcat ggcatcgtcc acagcttata       540
     cgcgggctgg atgccctcct ggcgcacttc gacttgaccg gatttcggaa gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page