(data stored in ACNUC1104 zone)

EMBL: CP002026.PE90

CP002026.PE90        Location/Qualifiers
FT   CDS_pept        80824..81171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0090"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_6109 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87427"
FT                   /db_xref="GOA:D7A013"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7A013"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87427.1"
FT                   /translation="MRVHVVEDDAGVSDSLSLILGNVGHKVIAYPDAESLFKAPPPEGR
FT                   DAVIVDLSLPGIPGAQLVRWLLNLATPPRVMVITGQSQSFIDHQLRGLKPTWLVRKPLD
FT                   ADTITRVLPAE"
     ttgcgcgtcc atgtggtgga agatgatgcc ggtgtgagcg attcgctctc cctcatcctc        60
     ggcaatgtcg gtcataaggt gattgcctat cccgacgcgg aaagcctgtt caaggcgcca       120
     ccgccggagg gacgggacgc cgtgatcgtc gatctgagcc tgcccggcat tcccggcgcg       180
     cagctggtgc gctggctgct caacctcgcc accccgccgc gcgtgatggt catcaccggc       240
     cagtcgcaga gcttcatcga ccaccagctg cgcggattga agccgacttg gctggtgcgc       300
     aagccgctcg acgccgacac catcacccgt gtgctgccgg ccgaatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page