(data stored in ACNUC1104 zone)

EMBL: CP002026.PE91

CP002026.PE91        Location/Qualifiers
FT   CDS_pept        81267..81908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0091"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: oan:Oant_2634 CRP/FNR family transcriptional
FT                   regulator; PFAM: regulatory protein Crp; cyclic
FT                   nucleotide-binding; SMART: regulatory protein Crp; cyclic
FT                   nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87428"
FT                   /db_xref="GOA:D7A014"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A014"
FT                   /inference="protein motif:PFAM:PF00325"
FT                   /protein_id="ADH87428.1"
FT                   /translation="MRQIVEERTGSPTRQPSYAEPHHPGLRVATHVTVLHEGDPARRIM
FT                   EVVEGAVMLTKLLPDGRRQVVELLGPGDVFGLAHDDAYACSAETLTPATIATHERSALE
FT                   RDPVLASRLLRRFEAQLCVMHSHALVLGRMSALERVAFFLLRLMPEGMVGGTLHLSMTR
FT                   QEIADFLGLTLETVSRAFSELKRRGFVALQRADEVRIQDRGSMRRLAGAL"
     atgcgacaga tcgtcgaaga acgcaccgga agcccgacgc gccagccgtc ctatgccgag        60
     ccgcaccatc ccggcctgcg ggtcgccacc catgtcaccg tgctgcacga gggcgatccg       120
     gctcggcgca tcatggaagt ggtcgagggc gcggtgatgc tcaccaagct gttgcccgac       180
     gggcgccgcc aggtggtcga gctgctcggg cccggcgatg tcttcggcct cgcccatgac       240
     gacgcctatg cctgctcggc cgagacgctg acgccggcga ccatcgccac ccatgagcgc       300
     agcgcgctgg agcgcgatcc ggtgctggcg agccggctgc tgcggcgctt cgaggcccag       360
     ctttgcgtta tgcattccca cgcgctcgtg ctcggccgca tgtcggcact ggagcgtgtc       420
     gccttcttcc tgctgcgcct catgcccgag ggcatggtcg ggggcacgct gcatctctcc       480
     atgacccggc aggagatcgc cgatttcctc ggcctgacgc tggagacggt gagccgggcc       540
     ttctccgaac tgaagcggcg cggcttcgtg gcgctccagc gcgccgacga ggtgcgcatc       600
     caggaccgcg gcagcatgcg ccggctcgcc ggcgcgctct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page