(data stored in ACNUC1104 zone)

EMBL: CP002026.PE95

CP002026.PE95        Location/Qualifiers
FT   CDS_pept        complement(85930..86433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rhi:NGR_b03860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87432"
FT                   /db_xref="UniProtKB/TrEMBL:D7A018"
FT                   /inference="similar to AA sequence:KEGG:NGR_b03860"
FT                   /protein_id="ADH87432.1"
FT                   /translation="MHRGHDHHHHDHGAGGHSHSHSHSHAHHAAPNHGHSPRPAAQWQT
FT                   PHLPEPPEDSDHAHVETDIDLVEKAFVEGFAGASDPTSFLRLANVPFDAITTDGTRVSL
FT                   LRVETDEVTDVGAVMPHLGGGSFRYDPLPAQMVSRRKRLRFVYFDGRQTLPLTLAEVRT
FT                   LAQT"
     atgcaccgcg gccacgatca tcaccaccac gaccacggag cgggtggcca tagccactca        60
     cattcccatt cgcacgctca ccacgcggct ccgaaccacg gccactcgcc gcgtccggcg       120
     gcgcagtggc agacgccgca tctgcccgag ccgccggagg acagcgacca tgcgcatgtc       180
     gaaacggata ttgatctcgt cgagaaggcc ttcgtcgaag gcttcgccgg cgccagcgat       240
     ccgaccagct tcctgcgcct cgctaatgtc ccgttcgacg ccattacgac ggacggaacc       300
     cgcgtcagtc ttttgcgcgt cgagaccgac gaggtcaccg atgtcggcgc ggtgatgccg       360
     catctgggcg gtggcagctt ccgctacgat ccgctccccg cccagatggt ctcgcgccgt       420
     aagcgcctgc gcttcgtcta tttcgacggc cgccagacgc tgcctttgac actggcggag       480
     gtacgcacgc tcgcgcagac gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page