(data stored in ACNUC1104 zone)

EMBL: CP002026.PE96

CP002026.PE96        Location/Qualifiers
FT   CDS_pept        complement(86575..87795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0096"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   rhi:NGR_b03870 putative SpeB,
FT                   arginase/agmatinase/formimionoglutamate hydrolase, arginase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87433"
FT                   /db_xref="GOA:D7A019"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D7A019"
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /protein_id="ADH87433.1"
FT                   /translation="MRHFPEPTAPQRSTRVAGLRPAPSRLRRHHPNFEIREMQGWRSLE
FT                   AEEKLSENGWRKEQQWALDMGLPGADSITDKSIPTFARGELPHFAGINTFLKAPYVENV
FT                   RDVGKYDAAVLGIPFDSGTTYRPGTRFGPQGIRRISALYTPYNYELGIDLREQMTLCDA
FT                   GDVFTIPANLEKSFDQISKGVSHVFSSGALPIMLGGDHSIGFPCVRGIAECTSKRIGII
FT                   HFDRHIDIQEKDLDERMHTTPWYWATNLPNVSPKNLVQLGIGGWQVPRYGVQEARKRGT
FT                   NVLTIDDIEKIGLEKTAEIALELAWKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLPR
FT                   EALKILGLVAAEGLCGLEVVEVSPPYDTSDITALFGLRVVVEALGSMVAHGKLGSHRHM
FT                   IDKPVSF"
     atgcgtcatt tccccgaacc taccgccccc cagcgttcca cccgtgtcgc gggcctgcgc        60
     cccgccccgt cgcgcctgcg ccggcatcat cccaatttcg agatcaggga gatgcagggc       120
     tggcgctcgc tcgaagccga ggagaagctc tccgagaatg gctggcgcaa ggaacagcaa       180
     tgggcgctcg acatgggcct gccaggcgcc gattccatca ccgacaagtc gatcccgacc       240
     ttcgcgcgtg gcgaacttcc gcacttcgcc ggcatcaaca ccttcctcaa ggcgccctat       300
     gtcgagaatg tccgcgacgt cggcaaatat gacgccgccg tgctgggcat cccgttcgac       360
     agcggcacga cctatcgccc cggcacccgc ttcgggccgc agggcatccg ccgtatctcg       420
     gcgctctaca cgccctataa ttacgaactc ggcatcgacc tgcgcgagca gatgacgctc       480
     tgcgacgccg gcgacgtgtt caccatcccc gccaatctcg agaagagctt cgaccagatc       540
     tccaagggtg tttcccacgt cttctcgtcc ggcgcgctgc cgatcatgct cggcggcgac       600
     cattccatcg gctttccctg cgtgcggggg atcgccgaat gcacctccaa acgcatcggt       660
     atcatccatt tcgaccgcca catcgacatc caggagaagg atctcgacga gcgcatgcac       720
     accacgccct ggtactgggc gacgaacctg ccgaacgtct cgccgaagaa cctcgtgcag       780
     ctcggcatcg gtggctggca ggttccgcgc tacggggtgc aggaggcgag gaagcgtggc       840
     accaacgtcc tgaccatcga cgacatcgag aagatcgggc tcgagaagac cgccgagatc       900
     gcgctggagc tggcgtggaa ggatgcggac gcggtctaca tctccttcga cgtggacagc       960
     atcgattgcg gcttcgtgcc cggcaccggc tggccggagc ccggcggctt cctgccgcgc      1020
     gaggcgctga agatcctcgg gctggtggcc gccgagggcc tatgcgggct ggaggtcgtg      1080
     gaggtctccc cgccctacga cacctccgac atcaccgctt tgttcggcct gcgcgtcgtc      1140
     gtcgaggcgc tcggctcgat ggtggcgcac ggcaagctcg gctcgcaccg gcacatgatc      1200
     gacaagccgg tgagtttcta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page