(data stored in ACNUC1104 zone)

EMBL: CP002026.PE98

CP002026.PE98        Location/Qualifiers
FT   CDS_pept        complement(88875..89540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0098"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; KEGG:
FT                   hna:Hneap_0843 uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87435"
FT                   /db_xref="GOA:D7A021"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D7A021"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADH87435.1"
FT                   /translation="MNAPTVLTDVALPPTTIVVDHPLIQHKLTLMRRSRTPANEFRLLL
FT                   REISMLLAYEVTRDMPTELIEIETPLATMQAPILSGKKLCLVSVLRAGGGILEGMLEIL
FT                   PAARVGHVGLYRDPVSLQAVEYYLKLPRDISERTAIVLDPMLATGNSAVAAVSEVKAAG
FT                   CQSIKFVCLIAAPEGLKVMHEAHPDVTVYAAAVDSHLNDHGYIVPGIGDAGDRIFGTK"
     atgaacgcgc ccaccgtgct gaccgacgtt gccctgccgc cgaccaccat cgtcgtcgac        60
     cacccgctga tccagcacaa gctcaccctg atgcgccgct cgcgcacgcc ggccaacgag       120
     ttccggctgc tgctgcgcga gatcagcatg ctgctcgcct atgaggtgac gcgcgacatg       180
     ccgaccgagc tcatcgagat cgagacgccg ctggcgacca tgcaggcgcc gatcctctcg       240
     ggcaagaagc tctgcctcgt ctcggtgctg cgcgccggcg gcggcatcct cgaaggcatg       300
     ctggaaatcc tgccggcggc gcgcgtgggc catgtcgggc tctaccgcga cccggtctcg       360
     ctgcaggcgg tcgagtatta tctcaagctc ccgcgcgata tctccgagcg caccgccatc       420
     gtgctcgacc cgatgctggc gaccggcaat tcggcggtgg cggcggtgtc cgaggtgaag       480
     gccgcgggct gccagtcgat caagttcgtc tgcctcatcg ccgctccgga aggactgaag       540
     gtgatgcacg aggcgcatcc cgacgtcacc gtctatgccg cggctgtcga cagccacctc       600
     aatgaccacg gctacatcgt gcccggcatc ggcgatgccg gcgaccgcat cttcggcacc       660
     aaatag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page