(data stored in SCRATCH3701 zone)

EMBL: CP002031.APLD

CP002031.APLD        Location/Qualifiers
FT   CDS_pept        complement(539175..540698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aplD"
FT                   /locus_tag="KN400_0507"
FT                   /product="sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83370"
FT                   /protein_id="ADI83370.1"
FT                   /translation="MTDANLVPLLIVTAALATFIITGLRARAREAGDYGFGGRYIGRIG
FT                   GGAAIASNWMSAASFLGMGGLLYLQGYYALAYVIGWTGGYVLLLVLMAGQIRRFGKYTA
FT                   PDFVGDRYASPGARLISAAISITISVIYCTAQFKGIGMLFGWLFATDYRTGVILGATVA
FT                   VGYVILSGMLGVARNQQLQYTLLIVSFILPLMALAHKLGYFWVLPQFGYGVAIQDLKRE
FT                   FGINFAAPFASAGLFQWVALCFTLMVGTAGLPHVLSRFYVVPNIRDARWSLVWGLFFIA
FT                   LIYWSAPAYAVFARLLEARSGMAPPPVAAGKMADIIVIKTAVMGGLPSWMIGILAAGAM
FT                   SAAFFTVAGLLITGAASLSHDIYYRLINPRASEGSKMALAKGAVVVLAAIVLAIALNPP
FT                   GLIAEITAVAFALAGNTIFPAFLLGIWWSRANRHGVIAGMLTGVLITFSTPLFGGLVPA
FT                   VAKVFPLTSSALIGAPLVIGVMIVVSLLTPPPPEAVRRFLAEQVHGHMD"
     atgactgacg cgaatctcgt ccccctcctt atcgtgacgg ctgccctggc caccttcatc        60
     attaccgggc tgcgggcacg ggcgcgggaa gcgggagact acggcttcgg cgggcgctac       120
     atcggccgga tcggcggggg tgccgccatt gccagcaact ggatgagcgc ggccagcttc       180
     ctgggcatgg gcggccttct ctacctccag ggctactacg cccttgcgta cgtcataggc       240
     tggaccggcg gctacgtgct gctgctggtc ctcatggccg gccagattcg ccgcttcggc       300
     aagtacacgg ccccggactt cgtgggggac cggtatgcgt cgccgggcgc gcgcctcatc       360
     tcggcggcca tttccattac tatttcggtg atctactgca cggctcagtt caagggaatc       420
     ggcatgctct tcggctggct cttcgccacc gactaccgca ccggagtcat tctgggcgcc       480
     accgtggcgg tggggtacgt aattctttcg ggaatgctgg gggtggcccg caaccagcag       540
     ctccagtaca ccctgctcat tgtctcgttc atcctccctc tcatggccct ggctcataag       600
     ctcggctact tctgggtact cccccagttc ggctacggcg ttgccatcca ggacctcaag       660
     cgcgagttcg gcatcaactt cgcagccccc ttcgcctcgg ccggcctctt ccagtgggtg       720
     gccctctgct tcacccttat ggttggcacc gccggtcttc cccacgtcct gtcgcgcttc       780
     tacgtggtcc caaacattcg cgacgcccgg tggagcctgg tctggggcct gttcttcatc       840
     gctctcatct actggtcggc tcccgcctac gccgtcttcg cccggctgct ggaggcccgc       900
     tccggcatgg cccccccgcc ggtggccgcc ggcaagatgg ccgacatcat cgtgatcaag       960
     accgcagtca tgggagggct tccctcctgg atgatcggca tcctggccgc cggcgccatg      1020
     agcgccgcct ttttcacagt ggcgggactg ctcatcaccg gcgcggcatc cctttcccac      1080
     gatatctatt accgcctcat caacccccgt gcctccgagg gttccaagat ggccctggcc      1140
     aagggtgcgg tggtggtcct tgcggcgatc gtcctggcca tcgcactgaa cccgccaggg      1200
     ctcatcgccg agatcacggc cgtcgccttc gccctggccg gcaacacgat cttccccgcc      1260
     tttctcctgg gaatctggtg gagccgcgcc aaccgccacg gtgtcatcgc cggaatgctg      1320
     accggcgtcc tcatcacctt ctccaccccc ctgttcggcg gcctggtacc ggcggtggcg      1380
     aaggtcttcc ccctcacctc atcggccctg atcggcgcgc cgctggtgat aggagtcatg      1440
     attgtcgtgt cgctgctcac gccgccgccc ccagaagcgg tgcgtcgctt cctggctgaa      1500
     caggttcacg gccacatgga ctga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page