(data stored in SCRATCH3701 zone)

EMBL: CP002031.ARGB

CP002031.ARGB        Location/Qualifiers
FT   CDS_pept        135888..136766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="KN400_0126"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82989"
FT                   /protein_id="ADI82989.1"
FT                   /translation="MQHLIDKANTLMEALPYIRRFSGKTIVIKYGGHAMADEALKESFA
FT                   LDVIMLKSLGINPVVVHGGGPQINETLKRYGIVSEFVKGMRVTDAATMQVVEMVLTGQV
FT                   NKEVVGYLNQHGGRAVGLSGKDGNLLLCRKLLQEVRQDDGTVESVDIGFVGDVVKVNQE
FT                   LIQTLEHGKFIPVIAPVGVGEQGESYNVNADLVAGRVAGALRAEKLILLTDVAGVKDKA
FT                   GALLSSIRLDTVPGLIDDGVITGGMIPKVTCCVDAIEEGVRKASIIDGRVLHAVLLEIF
FT                   TDVGVGTEIHR"
     atgcagcatc tcatcgacaa ggcaaatacc ctcatggagg cgctgccgta tatcaggcgc        60
     ttctccggca agaccatcgt cattaagtac ggcggccacg ccatggcaga cgaggccctg       120
     aaggaatcct tcgccctcga cgtcatcatg ctgaagtccc tcgggatcaa ccccgttgtg       180
     gtccacggcg gcggccccca gatcaatgag accctcaagc ggtacggcat cgtctctgaa       240
     ttcgtgaagg ggatgcgagt caccgacgcc gccaccatgc aggtggtgga aatggtgctc       300
     accggccagg tgaacaagga ggtggtgggg tacctgaacc agcacggggg cagggccgtg       360
     gggctctcgg gcaaggacgg caatctcctc ctctgccgca agcttctcca ggaggtcagg       420
     caggatgacg gcaccgtgga gtcggtggat atcggcttcg tgggcgacgt ggtcaaggtg       480
     aaccaggagc tgatccagac cctggagcac ggcaagttca tcccggtcat cgccccggtg       540
     ggggtaggcg agcagggaga gagctacaac gtgaatgccg acctcgtggc cggccgggtg       600
     gccggagccc tgcgggccga aaagctgatc ctgctcactg acgtggcagg ggtgaaggac       660
     aaggcggggg ccctcctctc cagcatccgc ctcgatacgg tgcccggcct catcgacgac       720
     ggtgtcatca ccggcggcat gatccccaag gtcacctgtt gcgtcgatgc catcgaggag       780
     ggggtcagaa aggcctccat catcgacggc cgggtgcttc acgcggttct gctggagatc       840
     ttcaccgacg tcggcgtcgg caccgagatc caccgatga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page