(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPB

CP002031.ATPB        Location/Qualifiers
FT   CDS_pept        complement(330627..331316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="KN400_0302"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83165"
FT                   /protein_id="ADI83165.1"
FT                   /translation="MVHPLLFLQFFRKLLEPLHISEAGADAIAYTWLIIVCLLIVSLIA
FT                   TKALKAVPTGMQNFMEVVIGGIENMVEETMGEKGKPYFPLIATLALFVLVSNLIGLIPG
FT                   FFPPTANLNTTAACAVIVFLSTHIVGIKKHGFHYLQHFMGPIWWLAPLMFFIEIIGHLS
FT                   RPLSLSLRLFGNMNGHELVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQ
FT                   GSLEEAH"
     atggttcatc cgcttctatt cctgcagttc ttcaggaaac tcctcgagcc gcttcacatc        60
     tctgaagcgg gtgcagacgc cattgcctac acgtggctca ttattgtctg cctgcttatc       120
     gtgtccctca tcgccacaaa agcactcaag gccgtgccga ccggaatgca gaacttcatg       180
     gaagtcgtga tcggcggcat tgaaaacatg gtagaggaga ccatgggcga aaagggaaag       240
     ccgtatttcc cgctcattgc taccttggca ctctttgttc tcgtttcaaa ccttatcggc       300
     ctgattcccg gtttctttcc ccccactgca aacctcaaca cgacggcagc ctgtgctgta       360
     attgtcttcc tttcgacaca cattgtcggc atcaaaaagc atggtttcca ctatctccaa       420
     cacttcatgg gaccgatctg gtggctggcc cccctgatgt tcttcattga gatcatcggg       480
     cacctgagcc gccctctttc cctctcgctc cgtcttttcg gcaacatgaa tggtcacgag       540
     ctggtgctca tgattttttt cgccctggcc cccttccttg ttcccctgcc gatgatgctt       600
     atgggcgtcc tggtgtcatt catccaggca tttgttttca tgcttctcgc tatgatctat       660
     atccaaggtt cgcttgagga agcacactaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page