(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPC

CP002031.ATPC        Location/Qualifiers
FT   CDS_pept        97258..97674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="KN400_0089"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82952"
FT                   /protein_id="ADI82952.1"
FT                   /translation="MAEKLKVDLVTPYKKILSEEVDEITATGALGEFSVLPGHAPFLTS
FT                   LKIGELTYKKSGQIVHLALNWGYFEVEDDKVTVLVETAERADEIDLERAKAALGRAEAA
FT                   LKKLSPEDKDYRVMEAALERALIRMQVAGKAARK"
     atggctgaaa aactgaaagt cgatctggtt accccttata agaagatcct gtcggaagaa        60
     gtcgatgaga tcacggcaac aggtgcgctg ggtgaattca gcgttctgcc ggggcatgcc       120
     ccctttctta cctcactgaa gattggggag cttacctata agaaaagtgg gcaaatcgtc       180
     catcttgcac tcaactgggg gtatttcgag gttgaggacg acaaggttac ggtactggtt       240
     gagaccgccg agcgtgccga cgagatagac ctcgagcgcg ccaaggctgc cctggggcgc       300
     gctgaagctg cactcaagaa gctttctccc gaagacaagg attaccgcgt tatggaagcg       360
     gcactggagc gtgcccttat ccggatgcag gttgccggaa aagctgcgag aaaataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page