(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPF

CP002031.ATPF        Location/Qualifiers
FT   CDS_pept        92163..92783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="KN400_0084"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82947"
FT                   /protein_id="ADI82947.1"
FT                   /translation="MAYAFKKNGLLKPFVSTAAICLLVAGTVVLCHASGGGEGAHHVDT
FT                   GKQMKDFMWRVIDFIALAGVIVWALKKANAKGALADRSANVEKALREAEEARTAAEKKF
FT                   AEYSEKLEKANQEIDGIYAAIRKEGELEKERIIAEARITAEKIREQATATATQEVLKAR
FT                   AELRDEAARLAVQMAEQALREAIKKDDQDRLVSEYLTKVENLH"
     atggcctacg cgtttaagaa aaacgggctc ctgaagcctt ttgtgtcgac tgccgcgatc        60
     tgccttctgg tggccggcac tgttgtactc tgccatgcct cgggtggcgg ggaaggcgcc       120
     caccacgtgg ataccggcaa gcagatgaag gatttcatgt ggcgggtcat cgacttcatc       180
     gctttggccg gcgtgattgt ctgggcgctc aagaaggcca atgccaaagg ggccctggct       240
     gatcgctcag ccaatgtgga aaaggccctg cgtgaggccg aagaggcgcg gaccgctgcc       300
     gagaagaaat tcgccgagta cagcgagaaa cttgaaaaag ccaatcagga aatcgacgga       360
     atttatgccg ccatccgcaa ggaaggtgag ctggagaaag agcgcattat cgctgaggcc       420
     agaatcactg ccgaaaagat acgtgaacag gctacggcga ccgctactca ggaagttctc       480
     aaggcccggg ccgaacttcg tgacgaagcg gcgcgcctcg cggtacagat ggccgagcag       540
     gctctgcgcg aggctatcaa gaaagatgac caggatcggc tggttagcga atatcttacc       600
     aaggtggaga acttacattg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page