(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPH

CP002031.ATPH        Location/Qualifiers
FT   CDS_pept        92780..93322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="KN400_0085"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82948"
FT                   /protein_id="ADI82948.1"
FT                   /translation="MISNAIARRYAKALVQLGAEEGAVDRFGVELGQFTALLDGNADLA
FT                   SVLKSPAYRIEAKREILRDVLAKLNLSGTVSNFLQVLLDRGRIGFTPQIAHSYAVFADE
FT                   LSGIVRPVLTSAFPLDDAQVEGMKSALAKATGKRVELSAQVDSALIGGVVTKIGDKVFD
FT                   GSVRTQLNRIQDILQKG"
     ttgatctcga acgctattgc acgtcgctac gccaaggcgc tggtgcagct cggggccgag        60
     gagggagcgg tcgaccggtt cggtgtcgag ttggggcagt tcacggccct tctcgacggg       120
     aatgccgacc tggcttccgt tctcaagagc cccgcgtacc gcattgaagc caagagggaa       180
     attctcaggg atgtccttgc gaagcttaat ctctccggca ccgtctccaa ttttctgcag       240
     gtactcctcg atagggggcg aatcggcttc actccccaga tcgcgcacag ctacgcagta       300
     tttgccgatg aactctccgg cattgtccgc ccggtcctca cgtcggcatt tcctttggac       360
     gatgcccagg ttgaggggat gaagagtgcc cttgccaaag cgaccggcaa gcgggtagag       420
     ctttcggctc aagtggactc cgctctcatc ggcggagtgg tcaccaagat tggcgacaag       480
     gtatttgacg gcagcgtacg gacccagttg aacaggattc aggatatatt acagaagggg       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page