(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPX

CP002031.ATPX        Location/Qualifiers
FT   CDS_pept        91735..92160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /locus_tag="KN400_0083"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82946"
FT                   /protein_id="ADI82946.1"
FT                   /translation="MISLDLAFVIQVINFLVLMIILNVFLFKPIRKVIADRKAQIDGSR
FT                   ERAAVVDKEVQEKMALYEARLRDVKAKAGAEREVLRKEAQQEESAILEKARKEAADSLA
FT                   SIKSRVAKETVDAKEFLKEQSRPLSLEICQKVLGRSL"
     gtgataagtc tcgatcttgc ctttgttatt caggtaatca acttcttggt tctcatgatc        60
     atcctgaacg tttttctgtt caagccgatc aggaaggtta tcgcggaccg gaaagcgcag       120
     atcgacggat ccagggaacg cgctgcggta gtcgacaaag aggtgcagga gaagatggcc       180
     ctctatgagg cgcgcctgcg cgatgtgaag gccaaggccg gtgctgagcg cgaggtgctg       240
     cgtaaggagg cccagcagga ggagtcggcg attcttgaga aggcccggaa ggaagctgcc       300
     gattcccttg cgtccatcaa gagccgggtg gccaaggaaa ccgtcgatgc caaggagttc       360
     ctgaaggagc aatcccgtcc cctgtccctt gaaatctgcc agaaagtgct cgggaggagt       420
     ctgtaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page