(data stored in SCRATCH3701 zone)

EMBL: CP002031.CBCA

CP002031.CBCA        Location/Qualifiers
FT   CDS_pept        complement(605034..606083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcA"
FT                   /locus_tag="KN400_0572"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome c subunit, putative, 7 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83435"
FT                   /protein_id="ADI83435.1"
FT                   /translation="MRTLRKTAIVLSLLAILPAAALAEDKTADACLSCHSSKDIGKSGS
FT                   HLYIDAAKYSRTTHAIIGCTSCHDSVTASHPDDGIRPSRAACRECHSPIAKEYTASLHA
FT                   NNAGCADCHDPHTVKPPALTSGRDMNAMCAKCHETAKMIEVHSKWLPQADLHIDALPCI
FT                   TCHTGSENYVITLYIQKRAGEKPQSDFKTATYEDLSRTLPGDRDVKAIIDTNNDNYISL
FT                   AELRSFNKSARHDGMRLWGMMTPEKVTHTYQILDNRWDCTFCHASGPRAMQTSFVAFPD
FT                   KNGTYSRVAVEKGAVLDLLYGTPDFYMMGSTRSMALSIIGGLIVSGGIAFAGIHGTFRF
FT                   LTRKNRKEH"
     atgcgcaccc tacggaagac ggcaattgtg ctgtcgctcc tcgcgatact ccccgccgcg        60
     gctctggctg aagacaaaac ggccgatgcc tgcctcagct gccacagcag taaggatatc       120
     gggaagagcg gttcccacct ctatattgat gccgcaaaat acagccgtac cacccacgcc       180
     atcatcggct gcacctcgtg tcatgacagt gtcactgcga gccaccccga cgatggcatc       240
     cgcccctcac gggctgcgtg ccgtgaatgc cattcaccga tcgccaaaga atacaccgcg       300
     agcctccacg ccaataatgc cggctgcgcg gactgccacg acccccatac ggtgaagccg       360
     cccgccctga cttccggccg ggacatgaac gccatgtgcg ctaaatgcca tgagacggca       420
     aaaatgatcg aagttcacag caaatggctt cctcaggcgg atctgcatat cgatgctctg       480
     ccgtgcatca cctgccacac cggttccgaa aactacgtga tcaccttgta catccagaag       540
     cgggccgggg aaaaacccca gagcgacttc aaaacggcga cctatgaaga tctctcccgc       600
     accctccccg gcgaccggga cgtgaaggcg atcatcgaca ccaataacga caactacatc       660
     tcattggccg agctgcgctc gttcaacaaa agcgccagac acgacggcat gagactctgg       720
     gggatgatga cccctgaaaa agtgacccac acctaccaga ttctggataa ccgctgggac       780
     tgcaccttct gtcacgcatc gggtccccgg gcaatgcaga cgagcttcgt cgcattcccc       840
     gacaaaaacg gcacctacag ccgcgttgcg gttgaaaaag gtgcggtcct cgaccttctc       900
     tacgggaccc ccgacttcta catgatgggc tccacccgca gcatggcact gtccatcatc       960
     ggcggactga tagtaagcgg cggcatcgcc ttcgcgggga ttcacgggac cttcagattc      1020
     ctgaccagga aaaacagaaa ggagcactga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page