(data stored in SCRATCH3701 zone)

EMBL: CP002031.CBCU

CP002031.CBCU        Location/Qualifiers
FT   CDS_pept        53446..54699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcU"
FT                   /locus_tag="KN400_0046"
FT                   /product="menaquinol oxidoreductase complex Cbc4,
FT                   cytochrome b subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82909"
FT                   /protein_id="ADI82909.1"
FT                   /translation="MVHGEAWTVKELFVYPNEYIYWTIQIVMYPFLTGLVAGAFVLSSL
FT                   YHVFGVKQLKDIARFSLVFSFALLPCAPLPLLLHLQQPLRNHHVLMTPHFTSAIAAFGI
FT                   VFLTYGMIVASELWFVYRGYFAATARQLKEQREHTRAETIKMRLYSVLVLGAWDVSHRA
FT                   LEQDERAVKILAAVGIPVACFLHGYAGFIFGSVKANALWMTPLMPVIFICSAVVSGIAL
FT                   CILTYIVTMELRKFVAAWRRRDNPGLPAPAEHGGEEANVVRMTSRYLIMFLILAITLEL
FT                   LDLIFRGYTAVKSWDILRSVIYGKDFVAIFVLQYGLGNLVPFILFLLPGLTVRRAVAGT
FT                   LLVLFGVFMMRWNVVIGGQAFSASFAGFMHYHLPIIPHDLETFKEGLFGALAVGSVPFV
FT                   LFWFLSRIFPVFGSDERH"
     atggtgcacg gggaggcctg gaccgtcaaa gagctgttcg tctatcccaa cgagtacatc        60
     tactggacca ttcagatcgt catgtacccg ttcctgaccg gcctcgttgc cggggccttc       120
     gtgctctcgt cactttacca tgtgttcgga gtcaagcagt tgaaggacat tgcccgcttt       180
     tcgctcgtct tttccttcgc gcttcttccc tgcgcgcctc tgccgcttct gctccacctg       240
     cagcagccgc tgcgcaacca tcatgtcctc atgacgccgc acttcacatc ggccattgcc       300
     gcctttggca tcgtcttcct cacctacggg atgatcgtcg cctcggagct ctggttcgtc       360
     taccgggggt attttgccgc cacggcccgg cagctgaagg aacagcggga gcacacccgg       420
     gcggaaacca tcaagatgcg cctctattcg gtgctggtgc tgggcgcctg ggacgtgagc       480
     caccgtgccc tggagcagga tgaaagggcc gttaagatat tggcggctgt tggcattccc       540
     gttgcctgct tccttcacgg ctacgcggga ttcatcttcg gttccgtcaa ggctaacgcc       600
     ctctggatga ctccgctcat gcccgtcatc ttcatttgct ccgccgtggt gtcggggatt       660
     gctctctgta ttctgaccta cattgtcaca atggagctgc gcaagttcgt tgcggcctgg       720
     cgacggaggg acaacccggg gctgccggcc cccgcggaac acggagggga ggaggccaac       780
     gtggtgagaa tgacctcgcg gtatctcatt atgttcctca ttctggccat tactctggag       840
     ctgctggacc tcatcttccg gggctacacg gcagtcaagt cgtgggatat cctgcgcagc       900
     gtcatctacg gcaaggactt tgtcgccatc tttgtgctcc agtacggcct cggcaacctt       960
     gtgccgttca ttctgttcct tctgcccggg ctcaccgtgc gccgggcggt tgcgggcacg      1020
     ctgctggtac tgttcggcgt ctttatgatg cgatggaacg tcgttatcgg cggtcaggcc      1080
     ttctccgctt catttgcagg tttcatgcac tatcatctgc cgatcattcc ccatgatctg      1140
     gaaacgttca aggaggggtt gttcggggcg cttgcggtcg gatcggtgcc ctttgttctg      1200
     ttctggtttc tttcccggat tttcccggtg ttcgggtccg atgaacgtca ctaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page