(data stored in SCRATCH3701 zone)

EMBL: CP002031.CHEB64H-1

CP002031.CHEB64H-1   Location/Qualifiers
FT   CDS_pept        complement(288949..290037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB64H-1"
FT                   /locus_tag="KN400_0264"
FT                   /product="protein glutamate methylesterase CheB associated
FT                   with MCPs of classes 40H and 40+24H, response receiver
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83127"
FT                   /protein_id="ADI83127.1"
FT                   /translation="MLQNQTRKLRVLVVDDSSFMRMVIRSVLEKDPAIEVVGIAVDGME
FT                   GVEKALALKPDLITMDIEMPRLDGISALKQVMAKCPTRVLMVSTLTCEGAKATFDALDA
FT                   GAIDYIPKNVTDSADAQRVFREELLRKVKGAASSIFGRPMTTSAPRAIIAPPRQVQPAP
FT                   RPSQALAGKFHYVGIGASTGGPVALQEVLGRIPGNYPHGIVVAIHMPKAFTGPYAERLN
FT                   SKCSLQIKEANDGDIIQPGVVLVAPGGRHMALARQGNSIVVRTLSTAECPQYIYIPSVD
FT                   HMMTTLADATNGSALGVILTGMGSDGFKGMKHLKSKGGITIVQDEATSTIYGMPRACIE
FT                   GGVADTVLPLTQIGSEIARLGG"
     atgcttcaga atcagacacg aaaactgcga gtcctggtcg tcgacgattc ttctttcatg        60
     aggatggtga tccggagcgt actcgaaaag gacccggcga tcgaggtggt cggcatagcc       120
     gttgatggga tggaaggggt tgaaaaagcc ctggccctga aaccggacct gatcaccatg       180
     gacatcgaga tgccacggct ggacgggatc tccgccctca aacaggtcat ggccaagtgc       240
     ccgacacggg tcctgatggt ctcaaccctc acctgcgagg gagccaaggc cacctttgac       300
     gccctcgatg caggcgccat cgactacatt ccgaaaaacg tgaccgacag cgccgatgcc       360
     cagcgagtct tccgggaaga gttgctgcgc aaggtcaagg gagccgccag ctctatcttc       420
     ggccggccga tgaccacatc ggccccccgg gcgatcatcg ctcccccccg gcaggtgcag       480
     cccgctccgc gcccctcgca ggcattggcc ggcaagttcc actacgtggg cattggcgcc       540
     tccaccggcg gcccggtggc gctccaggag gtcctgggcc gcatccccgg caactacccc       600
     catggcatcg tggtggccat ccacatgccc aaggcattca cggggcccta cgccgaacga       660
     ctcaacagca agtgttccct ccagatcaag gaggcgaatg atggcgacat catccagccc       720
     ggcgtggtcc tcgttgcccc gggcggtcgt cacatggcgc tggcccgcca gggaaactcg       780
     atcgtggttc ggacgctctc caccgccgag tgcccccagt acatctacat tccgtcggtg       840
     gaccacatga tgaccaccct ggctgacgcc accaacggat cggccctggg agtgatcctt       900
     acgggcatgg ggagcgacgg attcaagggg atgaagcact tgaaaagcaa gggtggcatc       960
     accatcgtcc aggacgaggc cacctccacc atctacggca tgccgcgggc ctgcatcgag      1020
     gggggcgtcg cagacacggt gcttcccctc acccagatcg gttcggagat cgcccgtctg      1080
     ggtgggtga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page