(data stored in SCRATCH3701 zone)

EMBL: CP002031.CHEX40H

CP002031.CHEX40H     Location/Qualifiers
FT   CDS_pept        complement(114899..115405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheX40H"
FT                   /locus_tag="KN400_0108"
FT                   /product="protein phosphoaspartate phosphatase CheX
FT                   associated with MCPs of class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82971"
FT                   /protein_id="ADI82971.1"
FT                   /translation="MALSFTVKEATFKEADLVGHIVESVKKIFSTMIFIDDIVDEYPLA
FT                   KPESHFIASISGMVGLGGDFSGMVGIHIPIEFAKEATASMLGMELDELEGEDDIHDAVG
FT                   EITNMLAGEIKMLFSANNLTVGLSTPSIISGSDYTVEVVSSGAAVVVPFNRNEHRFLAT
FT                   LQIEA"
     atggcgttga gttttaccgt caaggaagcc accttcaaag aagcggacct ggtgggacac        60
     atcgtggagt cggtcaaaaa aatattctcg accatgatct tcatagatga catcgtcgat       120
     gagtatcccc ttgccaaacc cgaatcccac ttcatcgcca gtatctcggg gatggtcggc       180
     ctcgggggcg atttttcggg gatggtcggc attcacattc ccatcgaatt cgccaaggag       240
     gcgaccgcat ccatgctcgg catggagttg gatgaactcg aaggcgaaga cgacatccac       300
     gatgccgtgg gcgagatcac caacatgctc gccggcgaaa tcaagatgct cttttccgcc       360
     aacaacctca cggtgggtct ttccaccccg tcgattatct ccggcagcga ttatacggta       420
     gaggtggttt ccagcggggc cgccgtggtg gtccccttca accgcaacga acaccgcttc       480
     ctggcaacgc tgcagatcga ggcgtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page