(data stored in SCRATCH3701 zone)

EMBL: CP002031.COXB

CP002031.COXB        Location/Qualifiers
FT   CDS_pept        198721..199635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="KN400_0197"
FT                   /product="cytochrome c oxidase, coo3-type, cytochrome c
FT                   subunit II, one heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83060"
FT                   /protein_id="ADI83060.1"
FT                   /translation="MRDFPTTTTEAVDPVFMFILGACILLLTGITVVMVAFVIRYHRSR
FT                   SPEPTSQAATNLWLEIIWTALPTVLVLAMFYYGWSSYLSLRHVPPGAMEVTAVARMWSW
FT                   SFEYQGGKTSPRLYVPVGKPVRVDLVSKDVLHGFYIPAFRVKRDVVPGMKNHVWFVAPK
FT                   AGSYDIFCSVYCGTGHSAMITTVEAVPETEFQAWLSHGEEGEKEKEGHGRELLEKHGCL
FT                   GCHSLDGSPRVGPTFKGIWGHQVTVTEGGVERTLSVDEAYLVRSIRQPAAQVVKGFPPV
FT                   MPPYQGLSDEEVEEMVEFIRELK"
     gtgcgcgatt tccctaccac cacaaccgaa gccgttgacc cggtcttcat gttcatcctg        60
     ggggcctgca tcctcctcct gaccggcatc acggtggtca tggtggcctt tgtcatccgc       120
     taccaccgct cccgctcccc cgagcccacg tcgcaggcgg cgacgaatct ctggctggag       180
     atcatctgga cggcccttcc cacggtgctg gtgctggcca tgttctatta cggctggtcc       240
     agctacctct cgcttcgtca cgtgccgccg ggggccatgg aagtgacggc cgttgcccgc       300
     atgtggtcct ggagcttcga gtaccagggt ggcaagacga gccctcgcct ctacgtgccg       360
     gtgggcaagc cggtgcgggt cgatctggtg tccaaagacg tgctccacgg gttctacatc       420
     cctgccttcc gcgtaaagcg ggacgtggtg ccggggatga agaaccatgt ctggttcgtg       480
     gctcccaagg caggttccta tgacatcttc tgctcggtct actgcggcac cggtcactcg       540
     gccatgatca cgacagtgga ggcggttccc gagacggagt tccaggcgtg gctcagccat       600
     ggggaggaag gggaaaagga gaaagaagga cacggcagag aactgctgga gaagcacggc       660
     tgcctcggct gtcattccct ggatgggtcc ccccgggtgg ggcccacgtt caagggaatc       720
     tggggccacc aggtgaccgt gacggaggga ggcgtcgagc ggaccctgag cgtggacgag       780
     gcgtatctcg tacgctccat ccgtcaaccg gcggcccagg tggtcaaggg attcccgccg       840
     gtcatgccgc cttatcaggg gcttagcgat gaagaggtgg aggagatggt ggaattcatc       900
     agggagctca agtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page