(data stored in SCRATCH3701 zone)

EMBL: CP002031.DMEF

CP002031.DMEF        Location/Qualifiers
FT   CDS_pept        complement(505019..506014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmeF"
FT                   /locus_tag="KN400_0474"
FT                   /product="cobalt/zinc/iron/cadmium/nickel efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83337"
FT                   /protein_id="ADI83337.1"
FT                   /translation="MHADSHLDRSITGRLKYAIALTALTLVAEIVGGIWTNSLALLSDA
FT                   AHVFLDLFALVLSLAAIKLASYPASDTKTFGWHRAEVFASFINGATVFLMALGIFYEAV
FT                   GRLMNPEAVKSLPMLLIATLGLVMNLISATALHGHSHDDLNVRSAFLHVVGDAAASVGV
FT                   IVGGLIMYFTGWYVLDALISIGIGCVIFAGSWRVLREAAHILLEGVPRGMSTQQVANEM
FT                   AGVEGVNAVHQMNIWTICSHILALSAHVDVKPEYKGQQAEVLRQIEQLLFERYHITHTT
FT                   LQAECTRCVDGPVIKDLRHRPRHGQSHDDHHHAHAHCTHGPHGHHHGHSH"
     atgcacgcag actctcatct ggacagaagc attaccggac ggctgaaata tgccatcgcc        60
     ctgactgcgc tgaccctcgt ggcggaaatt gtcggcggca tctggaccaa ctcgctcgcg       120
     ctcctgtcgg acgcggccca tgtgtttctc gatctcttcg ccctggtgct ctcgctggcc       180
     gccatcaagc tcgcgtcata ccccgccagc gacaccaaaa ctttcggctg gcaccgggcg       240
     gaggtctttg cctcgttcat caacggcgcc acggtctttc tcatggcact gggcatcttt       300
     tacgaggcgg tgggacggct gatgaacccc gaagcggtga agagcctgcc gatgctgctc       360
     atcgccactc tgggtctggt gatgaatctc atttcggcca cggccctcca tgggcactcc       420
     cacgacgatc ttaacgtccg cagcgccttc ctccacgttg ttggcgacgc ggcggcatca       480
     gtgggagtca tcgtcggcgg gctcatcatg tacttcaccg gttggtacgt cttggacgcc       540
     ctcatctcca tcggcatcgg ctgcgtcatc ttcgcaggct cgtggcgggt attgcgggag       600
     gcggcccaca ttctcctgga aggagtaccc cggggaatga gcacgcagca ggtggccaac       660
     gagatggcag gcgtggaagg ggtcaatgcc gttcatcaga tgaacatctg gaccatctgc       720
     tcccatatcc tggcgctgtc cgcccacgtg gacgtaaaac ccgagtacaa gggacagcaa       780
     gccgaggttc tacgacagat cgaacaactg ctctttgagc gttaccacat cacccacacg       840
     accctccagg ccgagtgcac ccgctgcgtc gacgggccgg tcatcaagga cctccggcac       900
     cgaccgcgcc acggccagag ccatgacgac catcaccacg cccatgcgca ctgcacccac       960
     ggcccccacg gacatcatca cgggcattca cactag                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page