(data stored in SCRATCH3701 zone)

EMBL: CP002031.DNAA

CP002031.DNAA        Location/Qualifiers
FT   CDS_pept        30..1367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="KN400_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82864"
FT                   /protein_id="ADI82864.1"
FT                   /translation="MEEVWLQAQSNLAKVLTHQTFNTWIEPIKYLGSKKNVLLLEAPNQ
FT                   FVRDRVSESYLPMILESVQSLTDSQTKIELLIAKPKTEKPKQPAASEVTAAEPEACSGP
FT                   DHSTNLNPKYTFDTFVCGGSNQFAHAAAQSVANSPAGKYNPLFIYGGVGLGKTHLLNAI
FT                   GNHVLSVNRKARICFYTSEKFMNELINCLRYQKMDQFRNKFRKMDILLIDDIQFIAGKE
FT                   RTQEEFFHTFNSLYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQAPDTETKV
FT                   AILRKKADADHISLPDDVALFLASSSTTNVRELEGMLIRLGAVSSLTGKNITLDMAREV
FT                   LKDIIVDKSKEITVEMIQKFVAEHFSLKVADLKSDKRLKALVIPRQIAIFLCRDLTKSS
FT                   YPEIGERFGGKDHSTIIHSVKKVEKLLSQDFELRNTVDTLRKGLLS"
     atggaagaag tttggctcca ggcacaatcc aatctcgcta aggttctcac acatcagacc        60
     tttaacacct ggatcgaacc gatcaagtat ctcggatcca agaagaatgt gctgctgctg       120
     gaagccccga accagttcgt cagggaccgg gtaagcgaaa gctatcttcc catgattctc       180
     gaatcggttc aatcgcttac cgattcccag accaagatcg aacttctgat cgcaaagccc       240
     aaaacggaaa aacccaaaca gcctgcggcc tctgaggtca ccgccgcgga accggaagcc       300
     tgttcggggc ccgatcactc aaccaacctg aaccccaagt acaccttcga cacgttcgtc       360
     tgcggcggca gcaaccagtt cgctcacgcg gcggcccagt cggtggcgaa cagcccggcc       420
     ggcaagtaca atcccctttt catatacggt ggcgtgggac tgggtaaaac ccacctcctc       480
     aacgcaatcg gcaaccatgt gctgtcggtg aaccgcaagg cacggatctg tttctacacg       540
     tcggaaaaat tcatgaacga actcatcaac tgcctgcggt accagaagat ggatcagttc       600
     agaaacaagt tccgtaagat ggacattctt ctcatcgacg acatccagtt catcgccggc       660
     aaggaacgga cccaggagga gtttttccac accttcaact cgctctacga atcccacaag       720
     cagatcgtag tgacgtccga caagttcccc aaggatattc ccggcctgga agagcgcctc       780
     cgctcacgtt tcgagtgggg cctcatcgcc gatatccagg cgcccgacac ggaaaccaag       840
     gtagcgatcc tgcgcaagaa ggcggatgcg gaccatatct cgctccccga cgatgtggcc       900
     ctgtttctgg catccagctc aacaaccaac gtgcgggaac tggaaggaat gctcatcaga       960
     ctcggtgccg tttcgagcct gaccggcaag aacatcaccc tcgacatggc acgggaagtc      1020
     ctcaaggaca tcattgtgga caagtcgaag gaaataacgg ttgagatgat ccagaaattc      1080
     gtggccgaac acttcagcct caaggtggct gatctcaaat cggacaagcg gctcaaggcg      1140
     ctggtgatac cacgccagat tgccatattc ttgtgccgtg atcttaccaa atcttcatat      1200
     ccggagatcg gtgaacggtt cggcggcaaa gatcattcaa ccatcatcca ctcggtgaaa      1260
     aaggtggaaa agctcctcag tcaggatttc gaactcagaa acaccgtcga caccctgagg      1320
     aaggggctgt tgagctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page