(data stored in SCRATCH3701 zone)

EMBL: CP002031.DNAK

CP002031.DNAK        Location/Qualifiers
FT   CDS_pept        42484..44394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="KN400_0034"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82897"
FT                   /protein_id="ADI82897.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVMEGGEPVVIANAEGSRTTPSMVAFAES
FT                   GERLVGQQAKRQAVTNPENTLFAIKRLIGRKYDTEEVRKDISISPFKIVKADNGDAWVE
FT                   ARGKMYSAPEISAMVLQKMKQTAEDYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGL
FT                   NVLRIINEPTAAALAYGLDKKKDEKIAVFDLGGGTFDISILELGDGVFEVKSTNGDTFL
FT                   GGEDFDQRVIDWIADEFKKDQGIDLRGDKMALQRLKEAAEKAKCELSTSMETDINLPFI
FT                   TADATGPKHLTMKLSRAKLEALCADLLNKLEGPCRTALKDAGLSPSEVDEVILVGGMTR
FT                   MPAVQKRVQEIFGKVPNKGVNPDEVVAIGAAIQGGVLRGDVKDVLLLDVTPLSLGIETL
FT                   GSVMTKLIEKNTTIPCRKSQVFSTASDNQPAVTIHVLQGEREMAIDNKTLGNFELTGIP
FT                   PAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVKEAEAH
FT                   SAEDKKKRELVEARNHADTLSYSTEKSLKEYGDKIGADEKAKIEECLANLRKAMEGSDV
FT                   EVLKKATDELTQASHKLAEAVYAKAQAEGAQPGGEAAGEASAKDEKVVDADFEEVKDDK
FT                   K"
     atgagcaaag tgatcggtat cgacctcggc accaccaact cctgcgttgc tgttatggaa        60
     ggtggtgagc cggttgtcat agccaacgcc gaaggaagcc gcaccacccc gtccatggtc       120
     gcattcgccg agagcggcga gcggctggtg ggccagcagg ccaagcgtca ggcggtgacc       180
     aatccggaga acaccctgtt cgccatcaag cggctcatcg gccgtaagta cgatacggaa       240
     gaggtgcgca aggacatctc catctccccc ttcaagatcg tcaaggccga caacggtgac       300
     gcctgggttg aggcccgcgg caagatgtac tcggcccctg agatctcggc catggtgctc       360
     cagaagatga agcagacagc cgaggactac ctgggcgaga ccgtgaccga cgcggtcatc       420
     accgtgccgg cctacttcaa cgactcccag cgccaagcca ccaaggacgc cggcaagatc       480
     gccggcctga acgtcctgcg gatcatcaac gagccgaccg ccgccgcatt ggcttatggc       540
     ctcgacaaga agaaggacga gaagattgcc gttttcgacc tggggggcgg aactttcgac       600
     atctccatcc tggaactggg tgacggcgtc ttcgaggtga agtccaccaa cggcgacacc       660
     ttcctgggtg gcgaagactt cgaccagcgg gtcatcgact ggatcgccga cgaattcaag       720
     aaggaccagg ggatcgacct gcgcggcgac aagatggccc tgcagcgcct caaggaggcc       780
     gccgagaagg ccaagtgcga gctctccacc tccatggaga ccgatatcaa ccttcccttt       840
     atcaccgctg atgcaaccgg gcccaagcac ctcaccatga agctgtcccg ggctaagctg       900
     gaggccctgt gcgccgacct gctcaacaag ctggaggggc cctgccgcac cgcgctcaag       960
     gatgccggtc tgtctccctc cgaggtggac gaagtgattc tggtcggcgg catgacacgg      1020
     atgccggcgg tccagaaaag ggttcaggag atattcggca aggttcccaa caagggggtt      1080
     aaccccgatg aggtggtcgc catcggcgcc gccattcagg gcggggtgct caggggcgac      1140
     gtgaaggacg tgctgttgct cgacgtgacc cccctttcgc tcggcatcga gaccctcggc      1200
     agcgtcatga ccaagctcat cgagaagaac accaccatcc cgtgccgcaa gagccaggtc      1260
     ttctccacgg ccagcgacaa tcagccggcg gtaaccatcc acgtgctcca gggagagcgg      1320
     gagatggcga tcgacaacaa gacattgggg aacttcgagc tgaccggcat cccgccggcg      1380
     ccccgcgggg tcccccagat cgaggtaacc ttcgatatcg acgccaacgg catcgttcat      1440
     gtttccgcca aggatttggg caccggcaag gagcaatcca tcaggatcac tgcatcctcc      1500
     ggcctctcca aggaagagat cgacaagatg gtcaaggagg cagaagctca ttcagccgag      1560
     gacaagaaga agcgggagct ggtggaagcc cgcaatcacg ctgataccct cagctactca      1620
     accgagaagt ctctcaagga atacggggac aagatcggtg ccgacgagaa agccaagatc      1680
     gaggaatgcc tggcaaacct cagaaaggcc atggagggaa gcgacgtaga ggtcctcaag      1740
     aaggccacgg acgagctgac ccaagcgtct cacaagctgg cagaggcggt ctacgccaaa      1800
     gcccaggccg aaggcgccca accaggcggg gaagcggcgg gtgaagcctc tgccaaggat      1860
     gagaaggttg tcgacgccga ctttgaagag gtcaaggacg acaagaaata a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page