(data stored in SCRATCH3701 zone)

EMBL: CP002031.DNAN

CP002031.DNAN        Location/Qualifiers
FT   CDS_pept        1594..2712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="KN400_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82865"
FT                   /protein_id="ADI82865.1"
FT                   /translation="MEFTIDRDTFSRALQKIQGIVEKRNTMPILSNVLIEALEDRIELT
FT                   ATDLEVGMKSSYPTTVASQGKITVSAKKLYEIVKELPDETISFLTKANDYVEIRCGKAK
FT                   FTIVGLSSEEFPYFPKVNEESFIRIESGLLADMIEKTSYAICFDETKYNLNGTFVKASE
FT                   EDGRSILRMVATDGHRLSITQREFNGAVSPEMAKGVIFPKKGIFELKKMCEEESTQLSL
FT                   GFLDNSAVIVKGNTVVVMRLVDGEFPDYTRVVPVANDRIVTVARDPFFHSLRRMSILSS
FT                   EKFKGIKMDIQESGMVISSSNPELGEASEELDAVFAGDAISIRFNAKYLIDVLAVLDES
FT                   SVALHLKDELSPAIVRPADGDGFTAVIMPMRL"
     atggaattca cgattgacag ggacaccttc tcgcgggctc tccagaagat ccaggggatc        60
     gtcgaaaagc gcaacaccat gccgatcctc tccaacgtcc tcatcgaggc actggaagat       120
     cggatcgagc tgaccgccac cgacctggaa gtcggcatga agagctccta ccccacaacg       180
     gttgcgagcc agggcaaaat caccgtatcg gccaagaagc tctatgaaat agtcaaggag       240
     cttcccgacg aaaccatatc atttctgacc aaagcgaacg actatgtgga gatccgctgc       300
     ggcaaggcca agttcactat tgtcggcctt tcctccgagg agttccccta tttccccaag       360
     gtcaatgaag agagcttcat caggatcgaa agcggcctgc tggccgacat gatcgagaaa       420
     acctcgtatg ccatctgctt cgatgagacc aagtacaatc tgaacggtac cttcgtgaag       480
     gcgtccgagg aagatggccg ctcgatactt cgcatggttg ccaccgacgg ccaccggctc       540
     tccatcaccc agagggaatt caacggtgca gtaagccccg agatggccaa gggggtcatc       600
     ttccccaaga aaggcatctt cgagctgaaa aagatgtgcg aggaggagtc gacccagctt       660
     tccctgggct tcctggataa cagcgccgtg atcgttaagg gaaacaccgt cgtggtgatg       720
     cgcctggtgg acggagagtt tcccgattac accagggtgg tgccggtggc caatgaccgg       780
     atcgtcaccg tggcgcggga tccgttcttc cattcgctgc gcaggatgtc catcctttcc       840
     agcgaaaagt tcaagggcat caagatggat attcaggaaa gcggcatggt gatctcttcc       900
     agcaacccgg aactgggcga ggcgtccgaa gaactggacg ccgtatttgc cggagatgcc       960
     atctccatcc gcttcaatgc caagtacctc atcgatgtgc tggcagtgct ggatgagagc      1020
     agcgtggcac tccacctgaa ggacgagctt tctccggcca tcgtgaggcc ggctgacggc      1080
     gacggtttca cagcggtaat tatgcccatg cgtctgtag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page