(data stored in SCRATCH3701 zone)

EMBL: CP002031.EHRB

CP002031.EHRB        Location/Qualifiers
FT   CDS_pept        764719..765627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrB"
FT                   /locus_tag="KN400_0718"
FT                   /product="Ech-hydrogenase-related complex, NuoH-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83581"
FT                   /protein_id="ADI83581.1"
FT                   /translation="MLDIIIHLLLAILMPPLLLGVIVKTKAAFAGRVGAPLLQPYYDIA
FT                   RLLRKGSVFSDTTTWVFRAGPVVTLAAPAVAALLVPLGNHPAPVSFAGDMILFAYLFGL
FT                   ARFFTTVAALDTGSSFEGMGAAREVTFSCLAEPTLFFALITLARMSGSLSLTPMLTHAT
FT                   AADWLTAGASLLLLVGALFLVLLVENCRIPFDDPTTHLELTMIHEVMVLDHSGPAFGLI
FT                   LYGAALKLFVLGAFFMNVALPVRTGNTLADWGIFVASMLVLAVAVGVVESVMARLRLIR
FT                   IPQLLVAATILSAFSMLLILR"
     atgctcgaca tcatcatcca tctgctgctg gcgatcctga tgccccccct gctcctgggg        60
     gtgatcgtca agaccaaggc cgcctttgcg ggccgggtcg gggcgccgct tctgcagcca       120
     tactatgaca ttgcgcggct gctgcgcaag gggagcgtgt tcagcgatac caccacctgg       180
     gtgttccgtg ccgggccggt ggtgaccctg gccgcccccg ccgtggcagc gctgctggtc       240
     cctttgggca accatccggc gccggtctcc tttgccggag acatgatcct ctttgcctac       300
     ctcttcggtc tggcccggtt cttcaccacc gtggccgccc tggacaccgg ctccagcttc       360
     gaggggatgg gggcggcccg ggaggtgacc ttttcctgtc tggccgagcc gaccctcttc       420
     ttcgccctga tcaccctggc ccgcatgagc ggcagcctgt ccctcacccc catgctcacc       480
     cacgccaccg cggcggactg gctcaccgcc ggcgcctccc tgctgctgct ggtgggggcg       540
     ctgtttctgg ttctcctggt ggagaactgc cgcatcccct ttgacgaccc caccacccac       600
     ctggaactga ccatgatcca cgaggtgatg gtgctggacc acagcggccc cgccttcggc       660
     ctgatcctct acggcgcggc cctcaagctc ttcgtgctcg gggccttctt catgaacgtg       720
     gcccttcccg tgcggaccgg caacaccctg gccgactggg ggatcttcgt ggcatccatg       780
     ctggtgctgg cggtggccgt gggggtggtg gaatcggtca tggcccggct gcgcctgatc       840
     cgcatcccgc aactgcttgt ggcggcgaca atcctctccg ccttttccat gctcctgatc       900
     ctgaggtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page