(data stored in SCRATCH3701 zone)

EMBL: CP002031.EHRC

CP002031.EHRC        Location/Qualifiers
FT   CDS_pept        765631..766272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrC"
FT                   /locus_tag="KN400_0719"
FT                   /product="Ech-hydrogenase-related complex, HyfE-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83582"
FT                   /protein_id="ADI83582.1"
FT                   /translation="MVSLADQLLVLVMLINFVVLGSSRMAFCIRAAAVQGVILGVLPGI
FT                   IHSFSWHLVAISGGIILAKGLVIPWLISDAVRKARIKREVEPFIGYVPTLILGAVATAL
FT                   AFVFSERLPLAPEHQDLLFVPAAIATLMTGFLVLTTRRKAISQVIGYLVLENGIFIFSL
FT                   LLTTAMPVMVEAGVLLDLLVGIFVMGIVINHISREFSSVDTSRLSALKEE"
     atggtttccc ttgccgacca actgctggtg ctggtcatgc tgatcaactt cgtcgtcctg        60
     gggtcgagcc ggatggcctt ctgcatccgg gccgccgccg tgcagggggt gatcctgggg       120
     gtgctccccg gcatcatcca ctccttctcc tggcacctgg tggccatctc cggcgggatc       180
     atcctggcca agggactggt gatcccctgg ctgatcagcg atgccgtgcg caaggcccgg       240
     atcaagcggg aggtggagcc gttcatcggc tacgtgccga ccctgatcct gggcgccgtg       300
     gccacggcct tggcctttgt cttctcggag cggctccccc tggccccgga gcaccaggac       360
     ctgctcttcg tgccggcggc catcgccacc ctgatgaccg ggttcctggt gctgaccacc       420
     cgacgcaagg ccatctccca ggtgatcggc tacctggttc tggaaaacgg catcttcatt       480
     ttcagcctgc tgttgaccac cgccatgccg gtcatggtgg aggccggagt gctcctggac       540
     cttctggtgg ggatcttcgt catgggaatc gtcattaacc acatcagccg cgagttctcc       600
     tccgtcgaca cctcgcgcct gagcgccctg aaggaggagt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page