(data stored in SCRATCH3701 zone)

EMBL: CP002031.EHRD

CP002031.EHRD        Location/Qualifiers
FT   CDS_pept        766277..767713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrD"
FT                   /locus_tag="KN400_0720"
FT                   /product="Ech-hydrogenase-related complex, HyfF-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83583"
FT                   /protein_id="ADI83583.1"
FT                   /translation="MLTAAVLLPLVGALAAWIVPDNRLRPLVLPAVAVPHFLLTLALLA
FT                   WTPPPSPQGWIFLDPLGKIVLLCISTLFLICAVYAVGYLAYRRDRSNRVLCMGLLACLS
FT                   AMTLVTASQHLGLLWVAVETTTVTMAPLIYFNRNARSIEATWKYLLICSVGIALALLGL
FT                   FFLAYATLVAHRDATLLLGPILASARELNPGWLHASFIFMLVGFGSKMGIAPLHSWKPD
FT                   AYGEAPGLVGALLAGGLVNCAFLAILRVYQISLASGGEYLFFQKALLTMGLISMGLAAV
FT                   FMARQADFKRMLAYSSVEHVGILAVALGLGKGALFGALFHLLNNGLTKGVLFLSSGNIH
FT                   RSFNSKSTEVVRGALARLPWSAGLFLAGFIAITGSPPFSPFVSEFSIVSSAFVEGRYLV
FT                   GGLFLFFLAVIFIGMALTVLPLVMGEPPADAERTDYRDRLLTVGPPLALLGLILMLGVW
FT                   LPEPLLRLLGEGAALLEAKS"
     atgctgaccg ccgccgttct cctgccgctc gtaggcgccc tcgcggcctg gatcgtcccg        60
     gacaaccggc tccgccccct ggtgctgccg gccgtggccg tcccgcattt cctcctgacc       120
     ctggcgctcc tggcgtggac cccgccgccg tccccccagg ggtggatctt cctggacccc       180
     ctcggcaaga tcgtgctcct ctgcatcagt accctgttcc tgatctgcgc cgtctacgcg       240
     gtgggctacc tggcctaccg ccgggaccgc tccaaccggg tcctctgcat ggggctgctg       300
     gcgtgcctct cggccatgac cctggtgacc gcctcccagc acctggggct cctctgggtg       360
     gcggtggaga ccaccaccgt gaccatggcg cccctgatct acttcaaccg caacgcccgc       420
     tccatcgagg ccacctggaa gtacctcctg atttgctccg tggggatcgc cctggcgctt       480
     ctggggcttt tcttcctggc ctacgcgacg cttgtcgccc accgggacgc caccctgctc       540
     ctggggccga tccttgcctc ggcccgggag ctgaacccgg gctggctcca cgcctccttc       600
     atcttcatgc tggtgggatt cggctccaag atggggatcg cgccgctcca ttcctggaag       660
     cccgatgcct acggcgaggc gccggggctc gtgggggcgc tcctggccgg gggactggtc       720
     aactgcgcgt ttctggccat cctgcgggtc taccagatca gcctcgcctc cggcggggaa       780
     taccttttct tccagaaggc actcctgacc atggggctca tctccatggg gctggcagcg       840
     gtctttatgg cgcgccaggc cgatttcaag cggatgctgg cctattccag tgtggagcac       900
     gtgggcatcc tggcggtggc cctggggctc ggcaaggggg ccctgttcgg ggcgctcttc       960
     cacctgctga acaacggcct caccaagggg gtcctctttc tctcatcggg caacatccac      1020
     cgcagtttca acagcaagag caccgaggtg gtgcgcggcg ccctggcccg gctcccctgg      1080
     tccgccggcc tcttcctggc cggtttcatc gccataaccg gctcgccgcc gttctccccc      1140
     ttcgtgagcg agttctccat cgtgagcagc gccttcgtgg aggggcgcta cctggtgggg      1200
     ggcctcttcc ttttcttcct ggccgtgatc ttcatcggca tggccctcac ggtgctgccc      1260
     ctggtcatgg gcgagccccc ggccgacgcg gaacggaccg actaccgcga ccggcttctg      1320
     accgtggggc ctcccctggc cctgctgggg ctgatcctga tgctgggggt ctggctgcct      1380
     gaaccgctcc tgcggcttct gggcgaaggg gccgccttgt tggaggccaa atcatga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page