(data stored in SCRATCH3701 zone)

EMBL: CP002031.ELBB

CP002031.ELBB        Location/Qualifiers
FT   CDS_pept        complement(56321..56974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="KN400_0049"
FT                   /product="isoprenoid biosynthesis amidotransferase-like
FT                   protein ElbB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82912"
FT                   /protein_id="ADI82912.1"
FT                   /translation="MKKIGVVLSGCGVYDGSEIHEAVLTLLAIDRNGAEAVCMAPSMEF
FT                   REVNHLTSQETGATRNALVEAARIARGKIRDVKDVSAVELDAVIFPGGYGAAKNLCTFA
FT                   EKGAAATINPEVARLIREMAVAKKPIGAICIAPALIAATLGRDYKPKVTIGTDAGTAAA
FT                   ITETGSEHVSCPVAEFVVDRENKIVTTPAYMLANRISEAAEGIEKAVKAVVEMA"
     atgaaaaaga tcggtgttgt tctttccggc tgcggcgtct atgacggtag cgagatccac        60
     gaggcggtcc tgacgctcct cgccatcgac cgcaacggtg ccgaggcggt ctgcatggcc       120
     ccgagcatgg agtttcgcga ggtgaaccac ctcacctccc aggaaaccgg tgccacccgc       180
     aacgcacttg tggaggcagc gcggatcgcc cggggtaaga ttcgggatgt gaaggatgtg       240
     tcggctgtgg aactcgatgc cgttatcttc cccggcggtt acggcgcggc aaagaacctg       300
     tgcacctttg ccgagaaagg ggcggcggcc accatcaacc cggaagtggc ccgcctcatc       360
     cgcgagatgg ccgtggccaa aaaacccatc ggagccatct gcatcgcccc ggcccttatc       420
     gccgccaccc tcggccgcga ctacaagccg aaggtgacca ttggcaccga cgccggcacc       480
     gccgccgcca ttacggaaac aggcagcgaa catgtttcct gcccggttgc cgagttcgtc       540
     gttgaccggg aaaacaaaat cgtcaccacg cccgcctaca tgctcgccaa ccgtatctcg       600
     gaagcggcag aggggatcga aaaagcggtc aaggccgtcg tcgagatggc ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page