(data stored in SCRATCH3701 zone)

EMBL: CP002031.FABG-1

CP002031.FABG-1      Location/Qualifiers
FT   CDS_pept        complement(462086..462826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG-1"
FT                   /locus_tag="KN400_0435"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83298"
FT                   /protein_id="ADI83298.1"
FT                   /translation="MEFKDSIVVVTGGTRGIGRAISLHFARQGALVTAAYRADDEAARA
FT                   LEAEAAGLPGSIAVIRADVGTAEGAMAVIDAASGESGTLHVLVNNAGIIRDGYLAMMAE
FT                   DDWDAVMRANLSPLFHCCKWGVRKMLARRRGAIINLSSVSAFAGTAGQTNYAATKGAAV
FT                   SFTKSLAREVGPLGIRVNAVAPGLIETEMIAGMKREMVDRIVGSSILGRTGRPEEVAEA
FT                   VAFLASDRASYITGQCLVVDGGIL"
     atggaattta aggatagcat cgtggtcgtc accggaggga cccgcgggat cggccgggcc        60
     atttcccttc acttcgcccg gcaaggggca ctggtgaccg ccgcctaccg cgccgacgat       120
     gaggcggccc gcgccctgga agccgaggcg gcggggctgc ccggctccat tgccgtgata       180
     cgggcggacg tgggcacggc agagggggcc atggccgtca tcgacgcggc gagcggggag       240
     agcggcaccc tccacgtcct cgtgaacaac gcggggatca tccgggacgg ctacctggcc       300
     atgatggccg aggacgactg ggatgcggtc atgcgggcca acctctctcc cctcttccac       360
     tgctgcaagt ggggggtacg gaagatgctc gccagacgaa ggggcgccat catcaacctc       420
     tcttccgtat cggcctttgc cggcactgcc gggcagacca actacgccgc aaccaagggg       480
     gccgcggtca gtttcaccaa atctctggcc cgggaagtgg gccctctcgg catcagggtg       540
     aacgccgtgg cgccgggact catcgaaacg gagatgattg ccggcatgaa gcgggagatg       600
     gtcgatcgga tcgtgggtag cagcatcctc ggccgcaccg ggcgcccgga ggaagtggcc       660
     gaagcagtgg ccttcctggc ctcggaccgg gcatcctaca taaccggcca gtgcctcgtg       720
     gtcgacggcg gaatcctctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page