(data stored in SCRATCH3701 zone)

EMBL: CP002031.FDNH

CP002031.FDNH        Location/Qualifiers
FT   CDS_pept        814138..814971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnH"
FT                   /locus_tag="KN400_0758"
FT                   /product="periplasmically oriented, membrane-bound formate
FT                   dehydrogenase, iron-sulfur cluster-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83621"
FT                   /protein_id="ADI83621.1"
FT                   /translation="MSAGAIDYSKTKTFLIDTTKCTGCRGCQVACKQWNQLKAENTTFF
FT                   TGEGYQNPPGMSEFTFTRVKFKDYQKHGQNEFAFYKEMCMHCNDPACASVCPVGAFEKT
FT                   AEGPVVYHSKKCIGCRFCMVACPFGIPKYEWSKAFPLVKKCTGCYSRVKNGLDPACATA
FT                   CPTAITYGPRDEMIKEAEKRMSARPDRYVKVVYGKEEAGGTTVLYLTQQPLDELGFKPV
FT                   TKRPLPSYTWQALRLVPGIFLTVGGTLSLITWFQHRKDRVRKEEEEQKNRKEGNQ"
     atgagtgccg gagccatcga ctattcaaaa accaagacgt tcctgatcga taccaccaag        60
     tgcaccggct gccgcggctg ccaggtggcc tgcaagcagt ggaaccagct gaaggccgag       120
     aatacgacct tcttcaccgg cgaaggctac cagaacccgc cggggatgag tgaattcacc       180
     ttcacccggg tcaagttcaa ggactaccag aagcacggcc agaacgagtt cgccttctac       240
     aaggagatgt gcatgcactg caacgatccc gcatgcgcct ccgtctgccc cgtgggtgcc       300
     ttcgagaaga ccgccgaagg gccggtggtc taccactcca agaagtgcat cggctgccgt       360
     ttctgcatgg tggcatgccc cttcggcatc cccaagtacg agtggagcaa ggcgttcccg       420
     ctggtcaaga agtgcacggg ctgctacagc cgggtgaaga acggcctcga tcccgcctgc       480
     gccaccgcct gccccacggc cataacctac ggtccccggg atgaaatgat caaggaggcc       540
     gagaagcgga tgtccgccag gcccgaccgc tacgtgaaag tggtctacgg caaggaagag       600
     gccggcggca ccacggtcct ctacctgacc cagcagcccc tggacgagct cggcttcaag       660
     ccggtcacca agcggccgct gccgtcctac acctggcagg ccctgcgcct cgtgccgggg       720
     atcttcctga ccgtgggcgg caccctctcc ctcattacct ggttccagca ccgcaaggac       780
     cgggtccgga aggaagaaga ggagcagaag aaccgcaagg aggggaacca atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page