(data stored in SCRATCH3701 zone)

EMBL: CP002031.FDNT

CP002031.FDNT        Location/Qualifiers
FT   CDS_pept        817697..817876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnT"
FT                   /locus_tag="KN400_0761"
FT                   /product="twin-arginine translocation pathway protein,
FT                   TatA/TatE family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83624"
FT                   /protein_id="ADI83624.1"
FT                   /translation="MFGFGMPEMIIILVIALVVFGPGKLPQLGQSLGASIRNFKKASLE
FT                   EPEKITVKEKDEHA"
     atgttcggat tcggcatgcc cgaaatgatc attatcctcg tcatcgccct ggtggtattc        60
     ggcccgggga aacttcccca gctgggtcag tccctgggcg cgagcatcag gaatttcaag       120
     aaggcgtctc tggaagagcc cgaaaagatt actgtaaagg aaaaggacga gcacgcctga       180
//

If you have problems or comments...

PBIL Back to PBIL home page