(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLGB

CP002031.FLGB        Location/Qualifiers
FT   CDS_pept        405249..405668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="KN400_0375"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83238"
FT                   /protein_id="ADI83238.1"
FT                   /translation="MPVDSMFGTTINVLAKAVDLRARNHTMISANLANAETPNYTPKAL
FT                   SFEKELGAALKGNKTGSPATTHPRHIPLKGQAASVQSVEGTVIETPAPTPGRDNNGVEL
FT                   EAEMSRMAENQIMYNASIQILTKKFEGMKYAIKGQ"
     atgcctgtcg actctatgtt cggaacgacc ataaacgtcc tggccaaggc ggttgacctg        60
     agggccagga accataccat gatctctgcc aacctggcca atgccgagac cccaaactac       120
     acgcccaagg ccctttcctt cgagaaggaa ctgggcgctg ccctcaaggg caacaaaacg       180
     gggagtcccg cgacgactca tccccgacac attcccctga aggggcaggc cgcctccgtt       240
     cagagcgtcg agggaacggt catcgagact ccggccccga cacccggtcg ggacaacaac       300
     ggggtggagc ttgaggccga gatgagtcgc atggccgaga accagatcat gtacaatgcc       360
     tcgatccaga tcctgaccaa gaagttcgaa ggcatgaaat acgccatcaa aggacagtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page