(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLGC

CP002031.FLGC        Location/Qualifiers
FT   CDS_pept        405671..406111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="KN400_0376"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83239"
FT                   /protein_id="ADI83239.1"
FT                   /translation="MDFFSAMQVSSSALSAERTRMNLISANLANANSTRTAEGGPYKRK
FT                   DAVFAATQVGEGFRSALDRMRKNAPQGVQVTGIVEDPNPPRLQYDPSHPDADAKGYVAL
FT                   PNVNVVEEMADMIAATRAYEANVTAMQAAKNMALKTLEIGSR"
     atggactttt tcagcgcaat gcaggtcagt tcttccgccc tttccgccga acggaccagg        60
     atgaacctca tctccgccaa cctggccaac gccaactcca cccgtaccgc cgagggaggc       120
     ccctataagc ggaaagatgc cgtgttcgcc gccacccagg tgggcgaggg attccgctcc       180
     gccctcgacc ggatgcgcaa gaatgctccc cagggggttc aggtgaccgg tatcgtggaa       240
     gatcccaatc cgccccggct gcagtacgac ccgagccatc ccgacgccga tgccaaggga       300
     tatgtggccc tgcccaatgt gaacgtggtc gaggaaatgg ctgacatgat cgccgcgacc       360
     cgggcctatg aggccaacgt gaccgctatg caggcggcca agaacatggc tctgaagacc       420
     ctggagatcg gctcgcggta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page