(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLGD

CP002031.FLGD        Location/Qualifiers
FT   CDS_pept        414019..414675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="KN400_0385"
FT                   /product="flagellar hook capping protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83248"
FT                   /protein_id="ADI83248.1"
FT                   /translation="MVYGVTNDTAAAAAAMKKSTGMNKDDFLKLFVTQLQNQDPLNPQD
FT                   STEFIGQLAQLTQVEQAYNTNSNLSNLLNLVNGATSLSAVSFIGKEITASGDLIKLTSG
FT                   TQPTLGYRLPATAQKVTIKIMDDTDTVVRTLTLGGTQAGDGSITWDGKDEKGNALPDGR
FT                   YTFSVTGTNAEGKDFDGAPLLLGRAEGVMLEGEEPYITIGGINVPLGNILSVKGA"
     gtggtatacg gcgtaaccaa tgacaccgcg gcggccgcag cggccatgaa gaagtccacc        60
     ggcatgaaca aggacgactt cctcaagctg ttcgttacgc aactccagaa tcaggacccg       120
     ctcaatcccc aggacagcac ggagttcatc gggcagctgg cacaacttac ccaggtcgaa       180
     caggcctaca acaccaacag caacctctct aatcttctca acctcgtgaa cggggcaacg       240
     agcctctcgg cggtctcgtt tatcggcaag gagatcactg ccagcggtga cctgatcaag       300
     ctcaccagcg gcacccagcc taccttgggc taccggcttc ccgccaccgc ccagaaggtg       360
     accatcaaga taatggatga caccgacacc gttgtcagga ccctgactct gggaggcacc       420
     caggcgggag acggctccat aacgtgggac ggcaaggacg aaaaaggaaa tgcgcttccg       480
     gatggacgct acaccttctc cgtcacggga accaacgccg aaggaaagga cttcgacgga       540
     gcaccgctgc tcctcggccg ggccgaaggg gtcatgttgg aaggggagga accctacatc       600
     accatcggcg gcattaacgt gccgctcggc aacatactct ctgtgaaagg agcgtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page