(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLHB

CP002031.FLHB        Location/Qualifiers
FT   CDS_pept        421105..422163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="KN400_0395"
FT                   /product="flagellar biogenesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83258"
FT                   /protein_id="ADI83258.1"
FT                   /translation="MSDDKHSKTEKPTAKKLDEAKKKGVPHSRDLTSTVTLIAAMVALY
FT                   TTGGFMFTTLKRTSGELLGSMGTFHLTEASVEHLLIKLFLVFLSVVMPFMLVVVISGLA
FT                   TTMVQVGFSMNSERITFKLDKLNPVTNAQKLFNKDSLVEMLKAVLKIVIVGYMSYKIMR
FT                   DEMDGLLFLADTDLAGILEVFKHLAFKLVIHTCGVLLILGVLDLAFVKWRFIDNLKMTK
FT                   QEVKDEHKESEGDPKVKGKIRQMQFQQAQKRLRKVIPTADVVVTNPTHYAVALKYERET
FT                   MAAPLVLAKGVDHMAQTIKAIARENNVMLVENRFLARELYAQVKEGQPIPESLYTAVAE
FT                   VLAYVYSLKGKI"
     atgtctgacg acaaacattc aaaaacagaa aaaccaacag caaagaagct ggacgaggcg        60
     aaaaagaaag gggttcccca cagtcgggac ctgacctcca ccgtaaccct tatcgccgcc       120
     atggttgcct tgtacaccac cggcggtttc atgtttacca ccctgaagcg gaccagcggc       180
     gagctgctcg gttccatggg tacgtttcac ctgaccgaag caagcgtcga acatctcctc       240
     atcaagctgt tcctggtatt tctcagcgtg gtcatgccgt tcatgctggt ggtggtgatt       300
     tcggggcttg caacgaccat ggtccaggtg ggcttctcca tgaacagtga acggatcacc       360
     tttaagctgg acaagctcaa tccggtcact aacgcccaga agctcttcaa taaggactcc       420
     ctggtggaga tgctcaaggc cgtcctcaag atcgtcattg tcggctacat gtcgtacaag       480
     atcatgcggg acgagatgga cggactgctt ttcctggccg ataccgatct ggctgggatc       540
     cttgaggttt tcaagcactt ggcattcaag ctggtcatcc atacctgcgg tgtacttctt       600
     atcctggggg ttctggacct ggccttcgtc aagtggcgtt tcatcgataa tctgaaaatg       660
     accaagcagg aggtcaagga cgagcacaag gagtctgagg gggacccgaa ggtcaagggt       720
     aagattcgtc agatgcagtt tcagcaagcc cagaaacgcc tgcgcaaggt tattcctacc       780
     gccgacgtgg tcgtcaccaa cccgacgcac tacgccgtgg cgctcaagta tgaacgcgaa       840
     accatggccg cgccactggt gctggccaag ggcgtcgacc atatggccca aaccatcaag       900
     gccatcgccc gtgagaacaa cgtgatgctc gtggaaaatc gtttcctggc ccgcgagctc       960
     tatgcccagg tcaaagaggg acaacccatt cccgagagcc tgtacaccgc ggtagcggag      1020
     gtgctggcct atgtgtacag cctgaagggg aagatctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page