(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIH

CP002031.FLIH        Location/Qualifiers
FT   CDS_pept        409118..409999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="KN400_0380"
FT                   /product="flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83243"
FT                   /protein_id="ADI83243.1"
FT                   /translation="MSSSKASRIIKVDQSPNQAIRSYSFGFIAADAPQELPPEADGFVP
FT                   FALGTPVPLPGLQSAEEPDPDPVVPFNLEGKVVLAEDELQARVDEVFRNGMDEGRRQAE
FT                   RGLANVFKSLRDGVAALTGLRSRVMKESEEDLLRLAVMIARKIVQREVAQDPQVLAAIV
FT                   AAAVGGCTERDRVVVRLNPDDYTQVSANRQAFLAGLGEESAITLAPDESIGPGGCLVET
FT                   ATGTVDARIEAQLDEIYRSLLEERSAPVEPSASPDTDSRADLAFGGEETIAPFKGQGAW
FT                   VKGSEEKPRDDV"
     atgtcctcgt ctaaggcctc ccgcatcatc aaggttgacc agtcgccgaa ccaggccatc        60
     cgcagctaca gcttcggctt cattgccgcg gatgcgcccc aggagctgcc gccggaagca       120
     gacggcttcg tcccctttgc cctgggtacg ccggtaccac tgcccgggct tcagtcggcg       180
     gaggaacccg atccggatcc ggtcgtcccg ttcaatctcg aggggaaggt ggtgctggcc       240
     gaggacgaac tccaagcgcg ggtggacgag gtcttccgca acggcatgga cgaagggcgc       300
     cgccaggcgg aacggggact cgccaatgtc ttcaagtccc tgcgggacgg tgtcgccgcc       360
     ctgaccgggc tgcgcagccg cgtcatgaag gagagcgagg aggatctgct gcggctcgcg       420
     gtgatgattg cccgcaagat cgtccagcgg gaggtggccc aggaccccca ggttctggcg       480
     gccattgttg ccgcggcggt ggggggatgc accgagcggg accgggtggt ggtccgcctg       540
     aaccccgatg attacactca ggtctcggcc aatcgccagg cattcctcgc ggggctcggc       600
     gaggagtcgg ccataaccct cgcccccgat gaatccatcg gcccgggggg atgtctggtg       660
     gagaccgcca ccggcacggt ggatgcccgg atcgaggcac agctggacga aatctatcgc       720
     tcgctgctgg aggagcgcag cgctcccgtg gagccgtcag cttcgccgga taccgattcc       780
     cgcgccgatc tcgcctttgg cggcgaggag accatcgctc ccttcaaggg gcagggcgcc       840
     tgggtcaagg gaagcgaaga gaaaccgcgc gacgatgtct ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page