(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIK

CP002031.FLIK        Location/Qualifiers
FT   CDS_pept        412555..413994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="KN400_0384"
FT                   /product="flagellar hook-length control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83247"
FT                   /protein_id="ADI83247.1"
FT                   /translation="MEIMQLLQIAPQVVPTGGIPSEAPAQPAGDDSLFASLFAGLLMPP
FT                   ITTNAATQEVLDASSESLENAARNQDQENPPATDATLASLVPPIPLPLPAEAAPAPEST
FT                   ASSSGTAAAAPVAPVSSPVTTTVAEPPASTMPHAMAQTAPTEAPVAAASSVPAGQTAAV
FT                   ADAGAAEKPVEVLNVAVERTPVRQAGADILPEAEQSPQSVGMTEEATAETRSPVRTMGP
FT                   TAAYPDRIPVRHAEGIPAGKADTVNPVEPRSAEVRADATTGSQVKALDVEVTVRDGSGE
FT                   QHFAEGHEQAFTGKESAAMKDVVSGHATHEAGKSTTAQPTETRSTSESSHSLRDSIMAQ
FT                   VRDAVTTREPNGNGRISIRLNPVELGELTINVRVADQQVKVDVVAANGQVRDILLNNLD
FT                   NLKENFSRQNLTMTGFDVSTGTGQGFEHQLFREGGQAGQGGTHFSFSRGDDLDGDIQAA
FT                   VEDTRRYVTDRRENGLVDVRL"
     atggaaatca tgcagttgct ccagattgcc ccgcaggtcg taccgaccgg cggaatcccg        60
     tctgaagccc ctgcccagcc tgccggcgac gacagtctct tcgcctcgct ctttgccggg       120
     ttgctcatgc cacccatcac gacgaacgca gccactcagg aagtactgga tgcgtcgagc       180
     gagtcccttg agaatgccgc ccggaaccag gaccaggaga atcctcccgc caccgatgca       240
     accctggcaa gcctggttcc tcccatcccg ctccctctgc ccgcagaggc cgcacccgca       300
     ccggaatcca ctgcctcttc gtccggaacg gcagcggcgg cgcccgttgc gccggtttcg       360
     tctccggtca ccacgaccgt ggccgagccg cccgcatcga ccatgcccca cgccatggcg       420
     cagaccgcgc cgacggaagc gccggttgca gccgcttctt ccgtcccggc cggacaaacc       480
     gcagcggttg ctgacgcagg cgcggcggaa aaaccggtgg aggtgctgaa cgttgccgtc       540
     gaacggaccc cggtccgcca ggcgggagcc gatatcctcc ctgaagcgga gcagtcgcca       600
     cagtccgtcg gcatgacgga ggaggcgacc gcggaaaccc gttctccggt gcgcaccatg       660
     gggccaaccg ctgcctatcc cgatcggata cccgtcaggc atgcggaagg tattccggca       720
     ggcaaggccg acactgtcaa cccggtcgaa cccaggtccg ctgaagtccg ggctgacgca       780
     acaaccggga gtcaggtcaa ggcgctggac gtggaagtga ccgtcaggga cggctcaggc       840
     gagcagcact tcgccgaagg ccacgaacag gcgttcaccg gcaaggagtc cgcggcgatg       900
     aaggatgtcg tctccggaca tgctactcac gaggcgggca agagcactac cgcccaaccg       960
     accgaaacca gatcgacgtc ggagtcgtca cattcgctcc gcgacagcat catggcccag      1020
     gttcgggatg ccgtcacgac ccgtgagccc aacggcaacg gccggatcag catcaggctc      1080
     aacccggtgg aactaggtga gctcacgatc aacgtccggg tggctgacca gcaggttaag      1140
     gtggatgtag tggcggccaa tggccaggta agggacattc tcctcaacaa cctcgacaac      1200
     ctgaaggaga atttctcccg ccagaacctg accatgaccg gtttcgacgt ctcaaccggc      1260
     accggccagg ggttcgagca ccagctcttc cgcgaggggg ggcaggcagg ccagggggga      1320
     acccatttct ccttctcccg cggtgacgac ctcgatgggg acatccaagc cgcagtggag      1380
     gacacgcgac gctacgttac ggaccggcgt gaaaacggcc tcgtcgacgt gaggctctga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page