(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIN

CP002031.FLIN        Location/Qualifiers
FT   CDS_pept        418401..418706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="KN400_0390"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83253"
FT                   /protein_id="ADI83253.1"
FT                   /translation="MSDFTKEETKDGELDRKNLEFILDIPLQLTVELGRTKILVKDVLQ
FT                   LNQGAVVELTKLAGEPLDVFVNSKLVARGEAVVVNEKFGVRLVDIVSPNERVEKVL"
     gtgagcgact tcacgaaaga agaaaccaaa gacggtgaac tggaccgcaa gaacctggag        60
     ttcattctcg atataccgct tcagctcacg gtggaactgg gccggaccaa gatcctggtc       120
     aaggatgtgc tccagctcaa tcagggggcg gtggtggaat tgaccaagct tgccggagag       180
     cccttggacg ttttcgtgaa ctccaagctc gtcgcccgcg gcgaggcggt ggtggtcaac       240
     gagaagttcg gggtccggct cgtggatatc gtcagcccca acgaacgggt ggagaaagta       300
     ctgtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page