(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIQ

CP002031.FLIQ        Location/Qualifiers
FT   CDS_pept        419986..420255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="KN400_0393"
FT                   /product="flagellar biogenesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83256"
FT                   /protein_id="ADI83256.1"
FT                   /translation="MSPDLVVQLARRSFEVTLMLAAPLLISGLVVGLAVSIFQAVTSIQ
FT                   EATLAFAPKIIAVMVALVIFFPWMMNYMSDFTREVYALIATMRR"
     atgagtcccg atctcgtcgt acagcttgcc cgccgcagct tcgaggtgac gctgatgctg        60
     gctgctccgc tgcttatttc cggccttgtg gtcggacttg ccgtcagcat ctttcaggcg       120
     gtcacctcca tccaggaggc gacccttgcc tttgccccca aaatcatcgc cgtcatggtc       180
     gccctggtga tctttttccc ctggatgatg aactacatga gcgacttcac ccgggaagtt       240
     tacgccctca tcgccaccat gcgacggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page