(data stored in SCRATCH3701 zone)

EMBL: CP002031.FXSA

CP002031.FXSA        Location/Qualifiers
FT   CDS_pept        complement(840426..840818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="KN400_0785"
FT                   /product="cytoplasmic membrane protein FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83648"
FT                   /protein_id="ADI83648.1"
FT                   /translation="MLLRLFLIFSVVPIIELYLLIRVGKLIGALPTVALLLVVSLAGAW
FT                   LVRSQGFVILRRIQDELAMGRLPAAGLLDGALVLLGGLLLLTPGFFSDVVGLFFIIPPT
FT                   RAVIKQFLGLWLQNRLARGQFVIRRF"
     atgctcctga gactctttct catcttcagt gttgttccga tcatcgagct ctacctcctc        60
     atcagggtgg gcaaactgat cggcgccctg cccaccgtgg ccctgctgct ggtcgtcagc       120
     ctcgccggcg cctggctggt ccgctcccag ggcttcgtga tcctgcgccg catccaggat       180
     gagctggcca tggggcggct cccggccgcc ggcctgctcg acggcgcgct ggttctcctg       240
     ggagggctgc tcctcctgac ccccggcttt ttcagcgacg tggtcggcct gttcttcatc       300
     attcccccca cccgtgccgt catcaagcag ttcctgggcc tctggctcca gaacaggctc       360
     gcccgcggcc agttcgtcat ccgccggttc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page