(data stored in SCRATCH3701 zone)

EMBL: CP002031.GCVH

CP002031.GCVH        Location/Qualifiers
FT   CDS_pept        376372..376746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="KN400_0344"
FT                   /product="glycine cleavage system lipoyl carrier protein
FT                   GcvH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83207"
FT                   /protein_id="ADI83207.1"
FT                   /translation="METYFTKEHEWVKVKEGVAAVGITEYAAHQLGDVTFVELPQVGKQ
FT                   VKQFEVLAAIESVKAASDIYAPVSGKVTQVNEALDDRPEIVNEAAEEAGWIAWIEMGDT
FT                   SELNGLLTREQYDEYLKGLE"
     atggaaacct atttcaccaa agagcacgag tgggtcaagg tcaaggaagg cgtggccgcc        60
     gtggggatca ccgagtacgc cgctcaccag ctgggagacg ttaccttcgt ggagctgccg       120
     caggtcggga agcaggtgaa gcagttcgag gtgctggcgg ccatcgagtc ggtgaaggcg       180
     gccagtgaca tctacgcccc ggtttcgggg aaggtgaccc aggtgaacga agcccttgac       240
     gatcgtcccg agatcgtgaa cgaggccgcc gaggaggcgg ggtggattgc ctggatcgag       300
     atgggggata cctctgaact gaacggtctc ctgacccgcg aacagtacga cgagtatctg       360
     aagggcctcg aataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page