(data stored in SCRATCH3701 zone)

EMBL: CP002031.GLYS

CP002031.GLYS        Location/Qualifiers
FT   CDS_pept        587025..589088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="KN400_0557"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83420"
FT                   /protein_id="ADI83420.1"
FT                   /translation="MSKELFLEIGTEEIPAGFLPKAMADMEAIVTKELENARLAFGEVK
FT                   TFATPRRLALVVKGLPTVQPDAEITALGPARNIAFGPDGTPSKAAEGFARGQGVDVASL
FT                   TLVSTEKGEYVAAVRKESGRPVPDLLAEILPRLVGGIPFRKSMRWADLDVRFARPIHWI
FT                   VALFDGVVVPFAFGNVQSGNVSRGHRFMANQPFPVRDFAHYLDECERHFVIPDPERRKE
FT                   TIRREIHRVAKTAGGHLLPDEGLLDEVAYLVEYPSVVHGTFSPDFLKVPREVLITSMRS
FT                   HQRYFSIVDDAGKLMPGFITINNTLTEDPSVVVKGNERVLRARLSDARFFFEEDQKVKL
FT                   ETRVESLKNVVYQQKLGTSYEKMERFRALAEGLADLLNPAVKAKTSRAAFLCKADLVSG
FT                   MVGEFPEVQGIMGREYALLQGEDAEVAAAIAEHYLPTQAGGDLPASDIGAFVSIADKLD
FT                   TICGCFGVGLIPTGSADPYALRRSALGIINIILDRGCRLSLEGEIGKALELLSAKLTRP
FT                   AAEVMADVLEFFRGRFVNLMADRYPADAVDAAIAAGFDDLVDAEARIGALAAFKGRPDF
FT                   DSLAVAFKRVCNIVKDGVDQPVDAALFQEPAEGALFAAFQQVRADVEARTASGDYLAAL
FT                   TGIAALKGAVDDFFDKVMVMAEDERVRTNRLALLTGIARLFGGVADFAKIAA"
     atgagcaagg aactgtttct cgaaataggc accgaggaga tccccgccgg cttcctgccc        60
     aaggccatgg ccgacatgga ggccatcgtc acgaaggagc tggagaacgc ccgccttgcc       120
     ttcggcgagg tgaagacctt cgccaccccc cgtcgtctgg cgctggtggt gaaggggctg       180
     ccgacagttc agcccgatgc cgagattacc gccctggggc cggccaggaa catcgccttc       240
     ggtcccgacg gcacgccgtc caaggcggcc gagggcttcg cccgtggcca gggggtcgac       300
     gtggcgtccc tgaccctggt ctccaccgag aagggcgaat acgtggccgc tgtccgcaag       360
     gagagcggcc ggccggtacc ggacctcctc gccgagatcc tgccgcggct ggtggggggc       420
     atcccgttcc gcaagtccat gcgctgggct gatctggacg tgcgtttcgc ccgcccgatc       480
     cactggatcg tggccctgtt cgacggggtc gtcgtcccct tcgccttcgg caacgtccag       540
     agcggcaatg tctcgcgggg gcaccggttc atggccaacc agccgttccc ggtccgtgac       600
     ttcgcccact acctggacga gtgcgagcgg cacttcgtga tccccgatcc cgagcggcga       660
     aaggaaacca tccgccggga gatccaccgg gttgccaaga ccgccggtgg ccacctcctc       720
     cccgacgagg gactcctgga cgaggttgct tacctggtgg agtaccccag cgtggtccac       780
     ggcaccttct cgcccgattt tctcaaggtt ccccgcgagg tgctcatcac ctccatgcgg       840
     agccaccagc gctacttctc catcgtcgac gacgccggca agctcatgcc cggtttcatc       900
     accatcaaca ataccctgac cgaggacccc tccgtggtgg tcaaggggaa cgagcgcgtc       960
     ctgcgcgccc gcctctccga cgcccgcttc ttcttcgagg aagatcagaa ggtgaagctg      1020
     gagacccggg tggagtcctt gaaaaacgtg gtctaccagc agaagctcgg cacctcctac      1080
     gagaagatgg agcgctttcg cgccctggcc gaggggctgg ccgacctcct caatccggcg      1140
     gttaaggcca agacatcccg ggccgccttc ctctgcaagg ccgacctggt ttcgggtatg      1200
     gtcggtgagt tccccgaggt acaggggatc atgggccgtg agtatgccct gctccaaggc      1260
     gaagacgccg aagttgccgc cgccatcgcc gagcactacc tccccaccca ggccggtggg      1320
     gacctccccg catccgacat cggcgccttc gtctccatcg ccgacaagct cgataccatc      1380
     tgcggctgct tcggggtggg gctgatcccc accggttcgg ccgatcccta tgccctgcgc      1440
     cgttcggccc tgggcatcat caacatcatt ctcgaccggg gctgccgcct ctcgctggaa      1500
     ggagagatcg ggaaggccct ggaactcctc tccgccaaac tgacccgccc cgccgccgag      1560
     gtgatggctg atgtgctgga attcttccgg ggccggttcg tgaacctcat ggccgaccgc      1620
     tatccggccg atgccgtgga cgcggccatt gccgccggct tcgacgacct ggtggacgcc      1680
     gaggcccgca tcggcgcact ggcggccttc aaggggcgcc cggatttcga ctccctggca      1740
     gtggccttca aacgggtctg caacatcgtc aaggacgggg tcgatcagcc cgtggatgcc      1800
     gccctgttcc aggagccggc cgagggtgcc ctgttcgcgg cgttccagca ggtccgcgcc      1860
     gacgtggagg cccgcaccgc atccggcgat tacctggctg cgctcaccgg tattgccgct      1920
     ctcaagggcg ccgtggacga cttcttcgac aaggtgatgg ttatggccga ggacgaacgg      1980
     gtccgaacaa accggttagc attgctgacc gggatcgccc ggctcttcgg aggcgtcgcg      2040
     gacttcgcga agatagccgc ctag                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page