(data stored in SCRATCH3701 zone)

EMBL: CP002031.GSPF

CP002031.GSPF        Location/Qualifiers
FT   CDS_pept        complement(321451..322662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="KN400_0295"
FT                   /product="type II secretion system inner membrane protein
FT                   GspF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83158"
FT                   /protein_id="ADI83158.1"
FT                   /translation="MPTFRYSAYTAGGRETSGTIEAESLKEAKLRLKRDGLYPRDIGPV
FT                   SETAGTVSRRFGGRNAGPAQVALMTRRLATLVGSQVPIYEAVTTLWEQEEPGEIKKALG
FT                   RIRERLAEGANLAKALSLEPRLFSESYVAMVAAGEASGALDAVLERVALFLEEQRAIRS
FT                   KITASLAYPTLMVLVGSAVMLFLLAFVIPKIVTIFEDNRAALPLITIALIKTSTFLRSF
FT                   WWACIAAVAGVVLLYRRLMKDDAFRLRRDRFLLRIPVVGSLLRQLILSRFAKVLGLLLS
FT                   SGVPVMRALEITAQVVVNRHYRAALTSVTAGLAEGGTLSGALRTTGLFPPLLVHMVAVG
FT                   EKGGELEEMLGKAGSAFEREFESSVSGLMALLEPLLVLAMGLTVGLVVVAVLLPIFELN
FT                   QLIR"
     atgccgacct tccggtatag cgcctatacg gccgggggac gggagacgtc cggcaccatc        60
     gaggctgaga gcctgaagga ggcgaagctt cgcctgaagc gggacggcct ctatccgcgt       120
     gacattggcc cagtctccga gacggcgggg accgtctccc gacgtttcgg agggagaaac       180
     gcaggccccg cccaggtggc tctcatgacc cgccggcttg ctacgttggt gggctcccag       240
     gtgccgatct acgaggcagt gaccacgctc tgggagcagg aggagcccgg cgagatcaaa       300
     aaggccctcg gccggattcg ggaacgcctg gccgagggag ccaacctggc caaggcactc       360
     tccctcgaac cgcggctttt cagcgagagc tacgtggcaa tggtggcggc aggcgaggca       420
     agcggcgccc tggacgccgt tttggagcga gtcgccctct tcctcgagga acagcgggcc       480
     attcggagca aaatcactgc ctcgttggcc tacccgacgc tcatggtcct ggtgggaagc       540
     gcggtaatgc tcttcctcct ggcctttgtc attcccaaga tcgtcactat ctttgaggac       600
     aatcgggcag ccctccccct catcaccatc gcccttatca agacgagcac ctttctccgc       660
     tcgttctggt gggcatgcat cgccgccgtg gccggagtgg tgctgctcta ccggcgtctc       720
     atgaaggacg atgccttccg cctccgccgc gaccgcttcc ttctgcggat tccggtggtg       780
     ggaagtctcc tgcgccaact catcctctcc cgcttcgcca aggtgctggg actcctcctt       840
     tccagcggtg taccggtcat gcgggctctc gaaatcacgg cccaggttgt ggtcaaccgc       900
     cactatcgtg ccgccctcac cagcgtaaca gccggattgg ccgaaggcgg caccctttcg       960
     ggggctctgc gtaccacggg actctttccg cctctcctgg tccacatggt cgccgttggc      1020
     gagaaggggg gagagcttga ggagatgctc ggcaaggccg gcagcgcctt cgagcgggag      1080
     ttcgagtcgt ccgtatccgg cctcatggcg cttcttgagc cgctcctcgt cctggccatg      1140
     gggctgaccg tagggctcgt ggtggtcgcg gtactgctcc ccatctttga acttaatcaa      1200
     ctcattcgct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page