(data stored in SCRATCH3701 zone)

EMBL: CP002031.HDRA

CP002031.HDRA        Location/Qualifiers
FT   CDS_pept        complement(68699..70696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrA"
FT                   /locus_tag="KN400_0065"
FT                   /product="heterodisulfide oxidoreductase, FAD-binding and
FT                   iron-sulfur cluster-binding subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82928"
FT                   /protein_id="ADI82928.1"
FT                   /translation="MSRIGVFVCHCGENISRTVDVERVAGELAKVPGVAFATDYKYMCS
FT                   DPGQGLLKKAVAEHRLDGVVVAACSPRMHEKTFRTAAKAAGLNPFLCEMANIREHCSWV
FT                   HEDRDEATAKAISIVEMMVARVKKDRRLVPITVPVTKRALVIGGGIAGIQAALDIADAG
FT                   HKVVLVEREPSIGGHMAQLSETFPTLDCSQCIMTPKMVDVANHPNITLHTYSEIESVDG
FT                   YIGNFQVTIRKKARSVDESKCTGCGVCMAKCPQKKIPNSFDKNLGMRPAIYVPFPQAVP
FT                   NTPVIDRENCTYFKSGKCGVCAKVCGPRAVDYEQQDQLIVEPAGAIVVATGFSLYDIGP
FT                   KPAGSPIEGYGEFGYGTIPDVIDGLTFERLASASGPTGGKIVRPSDGKEPKQVVFVQCV
FT                   GSRAREKGISYCSKICCMYTAKHTMLYKHKVHDGQAYVFFMDARTPGKNYDEFWRRAIE
FT                   EEEAVYIRGMVSRLYQKGDKVVVMGSDVHVGVQVEIEADLVVLATAVQAREGADSLAQK
FT                   LGISYDNYNFYSEAHAKLKPVECATAGVYLAGACQGPKDIPDTVSQASAAAAKVMTLFA
FT                   RDELEREPIVAKVDERRCVACLYCKKICPYGAVEEKEIRDRQGNLIRVVAYVNPGVCGG
FT                   CGTCQATCPSKSVELDGYTDEQIMAMIEVL"
     atgtcccgaa tcggcgtatt tgtctgccat tgcggcgaaa acatctcccg taccgttgac        60
     gtggagcgcg tggccgggga actggccaag gttcccggcg tcgcttttgc caccgactac       120
     aagtatatgt gctccgatcc ggggcagggc ctattgaaga aggcggtggc cgagcaccgg       180
     ctcgacggtg tcgtggtggc ggcctgctct ccccggatgc atgaaaagac ctttcgcacc       240
     gcggccaagg cggccggcct gaaccccttc ctctgcgaga tggccaacat ccgcgaacac       300
     tgttcctggg ttcacgagga ccgggacgag gcaaccgcca aggccatctc cattgtggag       360
     atgatggtgg cccgcgtcaa aaaggaccgg cggctcgtgc cgatcaccgt accggtcacc       420
     aagcgggccc tggtcatcgg cggcggcatc gccggcatcc aggcggccct ggatatagcc       480
     gacgcgggcc acaaggtggt gctcgtggag cgggagccct ccatcggcgg gcacatggcc       540
     cagctctccg agacctttcc caccctggac tgttcccagt gcatcatgac ccccaagatg       600
     gtggatgtgg ccaaccaccc caacataacc ctccacacct acagcgaaat cgagagcgtt       660
     gacggctaca tcggcaattt ccaggtgacc atccggaaga aggcccgctc cgtggacgag       720
     tcaaaatgca ccggctgcgg ggtctgcatg gccaagtgtc cccagaagaa gatcccgaac       780
     agtttcgaca agaacctggg gatgcgcccc gccatctacg tccccttccc ccaggctgtg       840
     cccaacacgc cggtcatcga ccgggaaaac tgcacctatt tcaagtctgg caaatgtggc       900
     gtctgcgcca aggtctgcgg cccccgggcc gtggactacg aacagcagga ccagctcatc       960
     gtcgagccgg ccggagccat cgtggttgcc accggctttt cgctctacga catcggcccc      1020
     aagccggccg gctcccccat cgaggggtac ggcgagttcg gctacggcac catccccgac      1080
     gtgatcgacg ggctcacctt cgagcggctt gcctccgcct cgggccccac ggggggcaag      1140
     atcgtccgcc cctccgacgg gaaggagccg aaacaggtgg tctttgtcca gtgcgtcggc      1200
     tcacgggccc gcgaaaaggg gatctcctac tgttccaaga tctgctgcat gtacacggca      1260
     aagcacacca tgctctacaa gcacaaggtg cacgacggcc aggcctatgt cttcttcatg      1320
     gacgcgcgga cgccgggtaa gaactacgac gagttctggc gccgggccat cgaggaagag      1380
     gaggcggtct acatcagggg aatggtctcc cgcctctacc agaaggggga caaggtggtg      1440
     gtcatgggga gcgacgtcca tgtgggtgtc caggtggaga tcgaggcgga cctggtggtg      1500
     ctcgccaccg ccgtgcaggc gcgggagggg gccgactccc tcgcccagaa gctcggcatc      1560
     tcctatgaca actacaactt ctactccgag gcccacgcca agctcaagcc cgtggagtgc      1620
     gccaccgccg gggtctatct ggccggggcc tgccaggggc ccaaggacat ccccgacacc      1680
     gtcagccagg cgtcggctgc agcggcaaag gtcatgaccc tcttcgcccg cgacgagctg      1740
     gagcgtgagc ccatcgtggc caaggtggac gagcggcgct gcgttgcctg cctctactgc      1800
     aagaagatct gcccctacgg tgccgtggag gagaaggaga tccgcgaccg ccaggggaat      1860
     ctgatccggg tcgtggctta cgtgaacccg ggggtctgcg gcggctgcgg cacctgccag      1920
     gccacctgcc cttcaaaaag cgtggagctg gatggctaca ccgacgagca gatcatggcc      1980
     atgatcgagg tgctctaa                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page