(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYAL

CP002031.HYAL        Location/Qualifiers
FT   CDS_pept        complement(103717..105417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyaL"
FT                   /locus_tag="KN400_0097"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82960"
FT                   /protein_id="ADI82960.1"
FT                   /translation="MAMIVVDPITRIEGHLRIQAEVNGGRITDAWSSCTMFRGIEKILK
FT                   GRDPRDAWYFTQRFCGVCTTVHSIASIRAVENALNVKIPLNAELIRNLIIGSQVVQDHV
FT                   IHFYHLHALDWVDVVSALKADPSKTATLAASISDWPLNSPTYFKSIQDRLAAFVNKGRL
FT                   GPFGNAYWGHPAYKLPPEANLMATAHYLEALDWQREIIKIHAILGSKNPHPQTFLVGGM
FT                   AVPIDPNSQNALNADKIAEIGQLLKKTRAFVEKVYIPDLLAVASFYTEWAGIGGGVGNY
FT                   LSYGEYPLDNSGKPEKLWLPQGIILNRDLSRVYPIDQRKITESVAHSWYEGEAAGVHPY
FT                   DETTEARYTGPTPPYEMLDTDGKYSWVKSPRYDGKPMETGPLATILVAYAAGHPGARGA
FT                   VDMVLGKLGAGPEALFSTLGRTAARGIETLLVARELSSWLDMLVANIAGGDLTIHNGEK
FT                   WDPATWPREAAGYGWHNAPRGALGHWIRIKDQKIENYQAVVPSTWNASPRDEKGQLGPY
FT                   EAALVGTPMADPGRPLEILRTIHSFDPCLACAVHVVDPKGGELVSVKVL"
     atggccatga tcgttgttga cccgatcacg agaatcgagg gacatctgcg catccaggcc        60
     gaggtgaacg gcggacggat caccgatgcc tggagctcct gcaccatgtt ccgtgggatc       120
     gaaaaaatcc tgaaggggcg cgatccccgc gacgcctggt atttcactca gcgtttctgc       180
     ggcgtctgca ccaccgtgca ctccatcgcc tccatccggg cggtggaaaa tgccctgaac       240
     gtgaagatcc ccctgaacgc cgaactgatc cgcaacctca tcatcgggag ccaggtggtt       300
     caggatcacg ttattcactt ctaccatctc cacgccctgg actgggtcga cgtggtctcg       360
     gccctcaaag ccgatccatc aaagacggcg accctggcgg cttccatctc tgactggccc       420
     ctcaattctc ccacctactt caagtcgatc caggaccggc tggcggcctt tgtcaacaag       480
     ggacgactgg gccccttcgg caatgcctac tggggtcacc cggcctacaa gttgccgccc       540
     gaggcgaacc tcatggccac ggcccactac ctcgaggcgc tggactggca gcgggagatc       600
     atcaagatcc acgccatcct cgggtccaag aacccccatc cccagacctt cctggtgggc       660
     ggcatggcgg tgccgataga tccgaactct cagaacgccc tcaacgcaga caagatcgcc       720
     gagatcggcc aactcttgaa aaagacccgg gccttcgtgg aaaaggtcta catccccgac       780
     ctgctggcgg tggcgtcctt ctatacagaa tgggccggca tcggcggcgg ggtcgggaac       840
     tacctctcct acggcgaata tcccctggac aacagcggca aacccgaaaa gctctggctc       900
     ccccaaggga tcattctgaa tcgggatctg tcccgggtct accccatcga ccagcgtaag       960
     atcaccgaga gcgtggctca ctcctggtac gagggggaag ccgcgggggt ccacccctat      1020
     gacgagacga ccgaggccag gtacaccggg ccgacaccgc cgtacgagat gctcgacacc      1080
     gacggcaagt attcctgggt aaagtcgccc cgttacgacg gcaaacccat ggaaaccggg      1140
     cccctggcga ccattttggt agcctacgcg gcaggccacc ccggggcaag aggcgcggtg      1200
     gacatggtcc tcggcaagct cggcgcgggc cccgaagcac tcttctcaac cctgggacgt      1260
     accgcggcca ggggaatcga gaccctgctc gtggcccgcg aactctcctc gtggctcgac      1320
     atgctcgtgg ccaacatcgc cggtggcgac ctcaccatcc acaacggcga aaagtgggac      1380
     ccggccacct ggccccggga ggctgccggg tatggctggc acaatgcccc ccgcggcgcg      1440
     ctcgggcact ggatcaggat caaagaccag aagatcgaga actaccaggc cgtggttccc      1500
     tccacctgga acgcctcgcc ccgggatgaa aaggggcagc tgggccccta cgaggctgcg      1560
     ctggtaggga ctcccatggc ggaccccggc aggccactgg agatcctccg gaccatccac      1620
     tccttcgacc cgtgcttggc ctgcgccgtg cacgtggtcg acccgaaagg aggagaactg      1680
     gtcagcgtga aggtcctgta g                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page