(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYBL

CP002031.HYBL        Location/Qualifiers
FT   CDS_pept        821852..823534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybL"
FT                   /locus_tag="KN400_0765"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83628"
FT                   /protein_id="ADI83628.2"
FT                   /translation="MSKRITIDPITRIEGHLRIDVEVNGGQVAKAWSSAQMWRGIETIL
FT                   KGRDPQDAWSYAQRFCGVCTTVHAISSIRSVENALNVEVPLNAQYIRNIMIAQHSVQDH
FT                   IVHFYHLSALDWVDIVSALKADPKKASSIAQSLSDWPGNSEKEFKAVQDKLKAFVASGQ
FT                   LGIFASGYWGHPAMKLPPEVNLIAVAHYLKALDYQRRASQAVAILGGKNPHVQNLVVGG
FT                   VATAVNMENIATLNMERIAFLRTLMEETREFVQKVYYPDLVAIASFYKEWFKYGAGVTN
FT                   YLAVPEFAEDTRNTKFGLPGGTIYGGDLGTFKAITTHQDAALIQGVTEGVAHAWYEGSD
FT                   SLHPWEGETKPQYTDFQENGKYTWCKSPRYNGKPMQVGPPAQVMAAYATGHPKVKKLVD
FT                   DAAAKLGIGPKELHSTMGRLFCRGVRAHVMADYSLEYLDKLVANIGKGDSTYANHTEIP
FT                   DGEYKGVGFHEAPRGALSHWIVIEKKKIKNYQAVVPSTWNASPRDENGVAGPYEACLVG
FT                   NPVAQPDKPLEVLRTIHSFDPCIACAVHTIDPAGKEITKVKVL"
     atgtctaaac gtatcaccat agaccccatc acccggatcg agggtcacct gagaatcgat        60
     gtggaagtga atggcggcca ggttgccaag gcctggtcct cggcccagat gtggcggggc       120
     atcgagacca tcctcaaggg gcgcgatccc caggacgcct ggtcctacgc ccagcgtttc       180
     tgcggcgtct gcactacggt gcacgccatc tcgtccatcc gttccgtgga gaacgccctg       240
     aacgtggaag ttcccctcaa cgcccagtac atccgcaata tcatgatcgc ccagcactcg       300
     gtgcaggatc acatcgtcca cttctaccac ctgtccgccc tggactgggt cgacatcgtg       360
     tccgccctga aggccgaccc gaagaaggcc tcctccatcg cccagagcct gtccgactgg       420
     cccggcaaca gcgagaagga gttcaaggcg gtccaggaca agctcaaggc gttcgtggcc       480
     agcggccagc tcggcatctt cgcctccggc tactggggcc atccggccat gaagctgccg       540
     cccgaggtga acctgatcgc cgtggcccac tacctcaagg ctctcgacta ccagcgccgg       600
     gcttcacagg ctgtggccat tctcggcggc aagaaccccc acgttcagaa cctggtggtg       660
     ggcggggtag ccaccgctgt gaacatggag aacatcgcca ccctcaacat ggagcggatc       720
     gccttcctcc gcacccttat ggaagagacc cgcgagttcg tccagaaggt ctactacccg       780
     gacctggtgg ccatcgcttc cttctacaag gaatggttca agtacggcgc cggcgtcacc       840
     aactacctgg cggtccccga gttcgccgaa gacacccgca acaccaagtt cggcctcccc       900
     ggcggcacca tctacggcgg cgatctgggt accttcaagg cgatcaccac ccaccaggat       960
     gcggcgctca ttcagggggt caccgaaggg gtggctcacg cctggtacga aggctccgat      1020
     tcgctccacc cctgggaagg ggagaccaag ccccagtaca ccgacttcca ggagaacggc      1080
     aagtacacct ggtgcaagtc gccgcgctac aacggcaagc ccatgcaggt tggaccgccc      1140
     gcccaggtca tggccgccta cgccaccggc catcccaagg tcaagaagct ggtggacgac      1200
     gccgcagcca agctcggcat cggtcccaag gagctccact ccaccatggg ccggctcttc      1260
     tgccggggcg tgcgcgccca cgtcatggcc gactactccc tggagtacct ggacaagctc      1320
     gtggccaaca tcggtaaggg tgactccacc tacgccaacc acacggaaat ccccgacggc      1380
     gagtacaagg gggtcggctt ccacgaggcg ccccgtggtg ccctgtccca ctggatagtc      1440
     atcgagaaga agaagatcaa gaactaccag gccgtggttc cgtccacctg gaacgcctcg      1500
     ccgcgggacg agaacggcgt tgccggtccc tacgaagcct gcctcgtggg caaccccgtg      1560
     gctcagccgg acaagccgct ggaagtgctg cgcaccatcc actccttcga cccctgcatt      1620
     gcgtgcgccg tccacaccat cgacccggcc ggcaaggaga tcaccaaggt caaggtcctg      1680
     taa                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page