(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYBT

CP002031.HYBT        Location/Qualifiers
FT   CDS_pept        824120..824293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybT"
FT                   /locus_tag="KN400_0767"
FT                   /product="twin-arginine translocation pathway protein,
FT                   TatA/TatE family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83630"
FT                   /protein_id="ADI83630.1"
FT                   /translation="MFGFGMPEMIIILVIALVVVGPSKLPQLGQALGSSIKSFKKGMNE
FT                   DEVKVINKTNEA"
     atgtttggat tcggaatgcc tgaaatgatc attatcctcg tcatcgccct ggtggtggtg        60
     gggccgtcca agctgcccca gctggggcag gcccttggca gcagcatcaa gagtttcaag       120
     aaggggatga acgaagacga agtgaaggtc atcaacaaga ccaacgaggc ctga             174
//

If you have problems or comments...

PBIL Back to PBIL home page