(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYPF

CP002031.HYPF        Location/Qualifiers
FT   CDS_pept        304124..306415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="KN400_0275"
FT                   /product="hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83138"
FT                   /protein_id="ADI83138.1"
FT                   /translation="MVLRLRIAVEGIVQGVGFRPFIFRLAAHHGIVGWVMNSGAGVVME
FT                   AEGDAGALAAFRSAIVSDAPPLAVIARIAIEEIAPQGDGSFVIGESGEGAGTVRVAPDG
FT                   DVCPDCLRELFDPSDRRYRYPFINCTNCGPRYSLVTAVPYDRSNTTMARFPLCDACRSE
FT                   YEDPMDRRFHAQPVACPDCGPTLRLVDASGAGLPGDPVDQTVELLTEGKIVAIKGLGGY
FT                   HLAVDAANDAAVAELRRRKHRDEKPFAVMARDMEAVARFALVDSVEARLLTGPEHPIVL
FT                   LRKRPSTILSGRVAPANGYIGTMLPYTPLHHLLLEERFAALVMTSGNLSDEPISYRDDE
FT                   AVERLSAIADAFLVHDREIRTRIDDSVIRVFRGSPLFLRRSRGYVPREVRLPVEIPPVL
FT                   AVGAELKGALCLTRGDRAFPSQHIGDLKNDTTLTSLAATAEHLQALLEIRPQLVAHDLH
FT                   PDYLSTGYAEGIAGLPRVAVQHHHAHLASCMADNGLDGSVIGVIFDGTGLGTDGTVWGG
FT                   EFLVGGYDGFRRAAHFRQVPLPGGDAAVREPYRMALAYLHDAFGADFFEQPVPWLTEVG
FT                   DEDRSLFLRMLERRINSPLTSSCGRLFDAVAAMVGLRRTVSYEGQAAIELEGQAEESAT
FT                   GRAYPFAVLSRQGAIEVDYRLMIRALMEDLAVQVSLPEMARAFHNTVAASVVDVCRKVR
FT                   SETGLDRIVLSGGVFQNRLLCEESCRLLEAEGFRVFTHRLVPPNDGGVALGQAVIAGVA
FT                   HRVPRSDKGE"
     gtggtgctca ggctcaggat agccgttgag ggcattgtcc agggcgtcgg gttccgcccc        60
     ttcatcttca ggctggctgc ccatcacggt atcgtcggat gggtcatgaa cagcggcgcc       120
     ggtgtcgtca tggaagctga aggtgatgcc ggcgccctcg ctgcctttcg ctccgccatt       180
     gtgagtgatg ccccccccct ggcggtcatt gcccgaatcg ccattgagga aattgcaccc       240
     cagggggatg gctcttttgt catcggcgag agcggcgagg gagcgggtac ggtgcgggtg       300
     gcccccgacg gcgatgtctg tccagactgc cttcgggaac tctttgaccc gtcggaccgg       360
     cgctaccgct atccgttcat caactgcacc aactgtgggc ctcgctattc cctcgtcact       420
     gctgtcccct acgaccggtc caatactacc atggcgcgct ttcccctgtg cgatgcctgt       480
     cggtccgagt acgaagatcc gatggatcgc agattccatg cccagcccgt agcctgcccc       540
     gactgcggcc cgacgctgag gctggtggat gcctcgggtg ccggtctgcc gggggacccc       600
     gtcgaccaaa ccgtggagct tctgaccgaa ggcaagatcg tcgcgatcaa ggggctcggc       660
     ggttatcacc tggcggtgga cgccgccaac gacgccgccg tggcggaact gcgacgacgc       720
     aagcaccggg atgaaaagcc cttcgccgtg atggcgcggg atatggaagc cgtggcgcgg       780
     tttgccttgg tcgactccgt ggaggcgcgg cttctgaccg ggcccgagca tcccatagtg       840
     ttgctgcgca aacggccaag taccatcctc tccggtcgag tggcccctgc caacggctat       900
     atcgggacca tgctccccta tacgccgctg caccacctgc tgctcgagga gcggttcgct       960
     gctctcgtca tgacaagcgg caacctgtcg gacgaaccca tttcctaccg ggatgatgag      1020
     gcggttgagc ggctttcggc gatcgccgat gcatttctgg tccacgaccg ggagattcgg      1080
     acccgcatcg atgattccgt catccgggta ttcaggggaa gccccctctt tttgcgccgc      1140
     tcccgcggct atgttccccg cgaggtacgg ttgcccgtgg agattccgcc cgttcttgcc      1200
     gtaggcgccg agctcaaggg cgccctgtgc ctcactcggg gagaccgggc gttcccgagc      1260
     cagcacatcg gtgacctcaa gaacgacaca accctgacgt ctctggcggc aacggcggaa      1320
     cacctgcagg cgctcctgga gatcaggccc cagttggtgg cccacgacct ccatcccgac      1380
     tatctttcca cgggctacgc cgaggggatt gccgggctcc cccgggtggc ggtccagcat      1440
     catcacgctc atctcgcctc ttgtatggcc gacaacggtc ttgacggcag cgtcatcggc      1500
     gtcatcttcg acggcaccgg cctcgggacc gacgggaccg tctggggggg cgagttcctc      1560
     gtgggcggat atgacggatt ccgccgggcc gcccacttcc ggcaggtacc cctgccgggt      1620
     ggagacgcgg ctgtgaggga gccgtatcgc atggcgctcg cttacctgca cgatgccttt      1680
     ggtgccgatt tctttgagca gccggtcccc tggctgaccg aggtagggga tgaggatcgc      1740
     tcgctgtttc tgcgcatgct ggagcgccgg ataaactctc ccctgacctc cagctgtggc      1800
     aggctcttcg atgccgtggc cgccatggtg gggctgcggc gcacggtgag ctacgagggg      1860
     caggcggcca tcgagctgga agggcaggcg gaagagtccg ccacgggacg ggcctatccc      1920
     tttgccgtgc tgagtcggca gggtgccatc gaagtggact accggctcat gatccgggca      1980
     ctgatggagg atcttgccgt gcaggtctcc ctcccggaga tggcccgggc gttccacaac      2040
     acggttgcgg cctctgttgt cgacgtctgc cgcaaggtac ggagcgagac cggcctcgac      2100
     cggatcgtcc tctcgggagg agtctttcag aaccggctcc tctgcgagga gtcgtgccgg      2160
     ctgcttgagg cagaagggtt ccgggtgttt acccaccgtc tcgttcctcc caatgacgga      2220
     ggcgtggcgc tggggcaggc cgtgattgca ggggtggccc accgtgtccc ccggagtgat      2280
     aaaggagaat aa                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page