(data stored in SCRATCH3701 zone)

EMBL: CP002031.ILVE

CP002031.ILVE        Location/Qualifiers
FT   CDS_pept        670729..671802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="KN400_0632"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83495"
FT                   /protein_id="ADI83495.1"
FT                   /translation="MEIRVAPLPAEQKKHKATDETALGFGRLFTDRMLVAEWKVGQGWV
FT                   DARIEPYAPFSLDPACAVFHYAQEIFEGLKAYKWADGSIALFRPEMNARRFNHSAERLC
FT                   MPEVPEDLFIGGIEQLVALERDWIPASAGTSLYIRPAMIAVEPALGVKPADHYYFFVIL
FT                   SPVGAYYASGFNPVKIMVEDQYVRAVPGGTGEAKTGGNYASSLRAGLEAKKKGFDQVLW
FT                   LDGVHRRYIEEVGAMNMLFAYGKTIVTSPLTGTILNGVTRDSVLKLAASRGYTIEERLI
FT                   DVNDLMADIRAGKVTEAFGSGTAAVVSPVGILAYKGESVTVGDGGVGPITRELYDTLTG
FT                   IQTGRIPDTFGWTRKIA"
     atggaaatca gagttgcacc acttcccgct gagcagaaga agcacaaggc cactgacgaa        60
     acagctctag gctttggtcg tctttttacc gaccggatgc ttgttgccga atggaaagtc       120
     gggcagggct gggtcgatgc gcgaattgag ccctatgctc cgttttcgct ggatcctgcc       180
     tgtgcggtat ttcactatgc ccaggagatt tttgaaggac tcaaggcgta taagtgggcg       240
     gatggttcca tagcactctt tcgccctgaa atgaatgccc gccgcttcaa tcattcagca       300
     gagcgtctct gcatgcccga ggtgccggaa gatcttttca tcggcggcat cgagcaactg       360
     gtggcgctcg agcgcgactg gataccggcc tccgcgggga cttccctgta tatccgcccc       420
     gcaatgattg ccgtggagcc ggctctcggc gtgaaacctg ccgatcatta ctactttttt       480
     gtgattcttt caccggtggg cgcctattac gcctctggat tcaatccggt gaaaatcatg       540
     gtggaagacc agtatgtccg cgccgtgccc ggcggcaccg gtgaagccaa gacaggcggc       600
     aattatgctt cgtcgctcag ggccggcctt gaggcaaaaa agaaggggtt tgaccaggtc       660
     ctctggcttg acggggtcca ccgtcgctac atcgaggagg ttggggctat gaatatgctg       720
     tttgcctacg gcaagaccat agtcacctcg cctctcacgg gcaccattct gaacggcgtt       780
     acccgcgact cggttctgaa actggccgcg agccgcggtt acaccattga agagcggttg       840
     attgacgtga acgatctcat ggccgatatt cgtgccggca aggtgaccga ggctttcggc       900
     agtggcactg ccgctgtcgt cagtcccgtt ggaatcctgg cgtacaaggg cgagagcgtg       960
     accgtaggcg acggtggcgt agggccgatc acccgggaac tctatgatac ccttaccggc      1020
     atccagacgg gccggattcc cgacaccttc ggctggaccc gcaaaattgc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page