(data stored in SCRATCH3701 zone)

EMBL: CP002031.MCP40H-11

CP002031.MCP40H-11   Location/Qualifiers
FT   CDS_pept        396571..398220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-11"
FT                   /locus_tag="KN400_0368"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, Cache_2 domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83231"
FT                   /protein_id="ADI83231.1"
FT                   /translation="MQIKRYRNWGILPKIMTISGITVVLIAALVLFVLLPLIGEKMMDG
FT                   KKEKTKSVVEVAYNLVADLGERAKRGEISEEEARKRAIDHVKQLRYQGKEYFWINDLTP
FT                   RMIMHPIKPELDGTDLSENKDPRGTYLFREFANICREKGEGFVPYLWPKPGASEPVEKI
FT                   SYVKLYEPWGWVIGSGIYVDDVRADMARLRWVVLGGTALFGLFALSLAFSVGLGVVRPL
FT                   RHAVTSLQDIAEGEGDLTRRIAVEREDESGELALAFNRFVEKLQGIVGTVANNALQVAA
FT                   AAGQVQEASRQMAEAAENVAGQAATVATASEEMAATSMEIAGNCVSLADGARHASETAE
FT                   SGAAVVQETVSVMGRIAERVKEAARTVDSLGSRSDQIGEIIGTIEDIADQTNLLALNAA
FT                   IEAARAGESGRGFAVVADEVRALAERTTRATREIALMIKAIQNETRGAVASMDEGVREV
FT                   EKGTGEAARSGAALREILEQIGSVSLQISQIATAAEQQTSTTTEISGSIQTITDTAHET
FT                   ARGAQESAGAAGQLADLAEQLQNVVMTFRLSA"
     atgcagatca agcgataccg caactggggc atcctgccga agatcatgac catctccggt        60
     attacggtcg ttctcatcgc agctctcgtc cttttcgtac ttctgccgct catcggcgag       120
     aagatgatgg acggcaagaa ggagaaaaca aagagtgtgg tcgaggtggc ctacaacctc       180
     gtggccgacc tgggagaacg cgccaagcgc ggggagatct ccgaggaaga ggcccggaaa       240
     cgggccatcg accatgtcaa gcaactccgc tatcagggca aggagtattt ctggatcaac       300
     gacctgacgc ccaggatgat catgcacccg atcaagcccg aactggacgg cacggacctg       360
     tctgagaaca aggatccgcg cggcacctac ctcttccgcg agtttgccaa tatctgccgg       420
     gagaagggag aggggttcgt cccctatctc tggcccaagc cgggagccag cgaaccagtg       480
     gaaaaaatct cgtacgtgaa gttgtacgaa ccttggggat gggtcattgg cagcggcatc       540
     tacgtggatg acgtgcgtgc cgacatggcc aggctccgtt gggtagtgct gggtgggacg       600
     gcgctctttg gcctgtttgc cctatcgctg gccttttccg tggggctcgg cgtggttcgg       660
     cccctgcggc acgcggtgac cagcctgcag gatatcgccg agggagaggg ggacctgacc       720
     cggcggatcg cggtggagcg ggaagacgag tcaggcgaac tggccctcgc cttcaacagg       780
     tttgtggaga aactccaggg tatcgtgggt acggttgcca acaatgccct gcaggtggcc       840
     gctgcggcgg gccaagtcca ggaggcgtcg cgccagatgg cggaagcggc agagaatgtg       900
     gccggtcagg cagccaccgt ggcaacggcc agcgaggaga tggccgccac gagtatggaa       960
     atcgccggta actgcgtctc acttgccgac ggcgcccgtc atgcgagcga aacggccgag      1020
     agcggagctg cggtggtcca ggagaccgtt agcgtcatgg ggcgcatcgc cgagcgggtc      1080
     aaggaggcgg cccgtacggt tgacagcctc ggttcccgta gcgaccagat cggggagatc      1140
     atcggcacga tcgaggatat tgccgaccag acgaatcttc tggccctcaa tgccgccatt      1200
     gaagcggcgc gggcgggtga atcgggtcgc ggcttcgcgg tagtagccga cgaggttcgg      1260
     gcgttggccg agcggaccac ccgggctacc cgcgagatcg ccctgatgat caaggcgatc      1320
     cagaacgaaa cccgcggggc agtggcatcc atggatgaag gagtgcgcga ggtggaaaag      1380
     ggcacgggcg aggcggcccg ttcgggggct gctctgcggg aaatcctgga gcagatcggc      1440
     tcggtttcgc tccagatcag ccagatagcc accgcggccg agcaacagac ctccaccacc      1500
     accgaaatca gcggcagcat ccagaccatc accgatacgg cccatgaaac cgcacgcggt      1560
     gcgcaggaat ctgccggagc cgcagggcag ctcgcagatt tggctgaaca attgcaaaat      1620
     gttgtcatga cattccggct ttcagcatga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page