(data stored in SCRATCH3701 zone)

EMBL: CP002031.MREB-2

CP002031.MREB-2      Location/Qualifiers
FT   CDS_pept        758172..759209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB-2"
FT                   /locus_tag="KN400_0712"
FT                   /product="cell shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83575"
FT                   /protein_id="ADI83575.2"
FT                   /translation="MASLREDMFGQASGDFAVDLGTTTTRVYRRGAGIVLSQPSMVAFR
FT                   RGDGGPARLLDAGSGARRMFGRTPAGIDVVRPLREGVVVDPAAGAHMLRSFFDSIPGCA
FT                   HRSLRIIIGVPAGGSGRDRDNARAVARMAGAGEVYLMEEPLALAIGAGADAADLWGTLV
FT                   VDVGGGTTEVALVASGGIQCLRSVPVGGDAMDAAIVGYLERERGVLVGERTAEELKIRL
FT                   GAATADSPAERARVRGRGVARGLPVEISVSSREVCAALRAPVAAIVAAVRSCLDGIPPA
FT                   VSLDLLDRGILMGGGGSLLHGLDRALEREVLLPVTRVSDPFSCVARGSAAVLDYLGVLR
FT                   RVERG"
     atggcatcgt tgcgagagga tatgttcggg caggcttccg gggactttgc cgttgatctg        60
     ggaacgacca ccacccgggt ctaccggagg ggggcgggca tcgtgctgtc ccagccgtcc       120
     atggtggcgt tccggcgcgg cgacggcggt ccggcacggc tgctggacgc ggggagcggc       180
     gcccgccgga tgttcggccg gaccccggcg ggcatcgacg tggtaaggcc cctgcgcgag       240
     ggggtggtcg tggatccggc ggccggggcg cacatgctgc gttcgttttt cgacagcatt       300
     cccggctgcg cccacagatc cctgcggatt atcatagggg tcccggctgg gggcagcggt       360
     cgcgatcggg acaacgcccg cgccgtggcc cgtatggccg gtgccggcga ggtgtacctg       420
     atggaagagc cactggccct ggccatcggt gccggcgccg atgccgcaga cctgtgggga       480
     accctcgtgg tggacgtggg aggggggacc accgaagtgg ccctggtggc ctcgggaggc       540
     atccagtgcc tccgttcggt gcccgtgggg ggagatgcca tggatgcggc cattgtcggc       600
     tacctggagc gggagcgtgg agtgctcgtg ggggaacgga cggccgagga actcaagatc       660
     cggctcggcg cggccacggc cgacagccct gccgaacggg cccgggtgcg tgggcgcggc       720
     gtggcgcgag ggttgccggt tgagatttcg gtaagcagcc gcgaggtgtg cgctgccctg       780
     agggcgccgg tggccgccat cgtggcggca gtgcgatcat gcctcgacgg gattccgccg       840
     gccgtgtccc tggatctcct ggatcggggc atcctgatgg ggggcggcgg gtccctgctg       900
     cacggcctgg accgggccct ggagcgggag gtgctgctgc cggtcacgcg ggtgagcgat       960
     cccttttcct gcgtggcccg aggctcggcc gcggtgctcg actacctggg ggtgctccgg      1020
     cgggtcgaac gggggtag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page